KEGG   Shigella sp. PAMC 28760: A0259_14940Help
Entry
A0259_14940       CDS       T04390                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
shq  Shigella sp. PAMC 28760
Pathway
shq00071  Fatty acid degradation
shq00280  Valine, leucine and isoleucine degradation
shq00310  Lysine degradation
shq00362  Benzoate degradation
shq00380  Tryptophan metabolism
shq00620  Pyruvate metabolism
shq00630  Glyoxylate and dicarboxylate metabolism
shq00640  Propanoate metabolism
shq00650  Butanoate metabolism
shq00900  Terpenoid backbone biosynthesis
shq01100  Metabolic pathways
shq01110  Biosynthesis of secondary metabolites
shq01120  Microbial metabolism in diverse environments
shq01130  Biosynthesis of antibiotics
shq01200  Carbon metabolism
shq01212  Fatty acid metabolism
shq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:shq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A0259_14940
   00630 Glyoxylate and dicarboxylate metabolism
    A0259_14940
   00640 Propanoate metabolism
    A0259_14940
   00650 Butanoate metabolism
    A0259_14940
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A0259_14940
   00072 Synthesis and degradation of ketone bodies
    A0259_14940
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A0259_14940
   00310 Lysine degradation
    A0259_14940
   00380 Tryptophan metabolism
    A0259_14940
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A0259_14940
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A0259_14940
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A0259_14940
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shq04147]
    A0259_14940
Enzymes [BR:shq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A0259_14940
Exosome [BR:shq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A0259_14940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AMR23843
UniProt: A0A142H4N5
Position
2996597..2997781
Genome map
AA seq 394 aa AA seqDB search
MKNCVIVSAVRTAIGSFNGSLASTSAIDLGATVIKAAIERAKIDSQHVDEVIMGNVLQAG
LGQNPARQALLKSGLAETVCGFTVNKVCGSGLKSVALAAQAIQAGQAQSIVAGGMENMSL
APYLLDAKARSGYRLGDGQVYDVILRDGLMCATHGYHMGITAENVAKEYGITREMQDELA
LHSQRKAAAAIESGAFTAEIVPVNVVTRKKTFVFSQDEFPKANSTAEALGALRPAFDKAG
TVTAGNASGINDGAAALVIMEESAALAAGLTPLARIKSYASGGVPPALMGMGPVPATQKA
LQLAGLQLADIDLIEANEAFAAQFLAVGKNLGFDSEKVNVNGGAIALGHPIGASGARILV
TLLHAMQARDKTLGLATLCIGGGQGIAMVIERLN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattgtgtcatcgtcagtgcggtacgtactgctatcggtagttttaacggttca
ctcgcttccaccagcgccatcgacctgggggcgacagtaattaaagccgccattgaacgt
gcaaaaatcgattcacaacacgttgatgaagtgattatgggtaacgtgttacaagccggg
ctggggcaaaatccggcgcgtcaggcactgttaaaaagcgggctggcagaaacggtgtgc
ggattcacggtcaataaagtatgtggttcgggtcttaaaagtgtggcgcttgccgcccag
gccattcaggcaggtcaggcgcagagcattgtggcggggggtatggaaaatatgagttta
gccccctacttactcgatgcaaaagcacgctctggttatcgtcttggagacggacaggtt
tatgacgtaatcctgcgcgatggcctgatgtgcgccacccatggttatcatatggggatt
accgccgaaaacgtggctaaagagtacggaattacccgtgaaatgcaggatgaactggcg
ctacattcacagcgtaaagcggcagccgcaattgagtccggtgcttttacagccgaaatc
gtcccggtaaatgttgtcactcgaaagaaaaccttcgtcttcagtcaagacgaattcccg
aaagcgaattcaacggctgaagcgttaggtgcattgcgcccggccttcgataaagcagga
acagtcaccgctgggaacgcgtctggtattaacgacggtgctgccgctctggtgattatg
gaagaatctgcggcgctggcagcaggccttacccccctggctcgcattaaaagttatgcc
agcggtggcgtgccccccgcattgatgggtatggggccagtacctgccacgcaaaaagcg
ttacaactggcggggctgcaactggcggatattgatctcattgaggctaatgaagcattt
gctgcacagttccttgccgttgggaaaaacctgggctttgattctgagaaagtgaatgtc
aacggcggggccatcgcgctcgggcatcctatcggtgccagtggtgctcgtattctggtc
acactattacatgccatgcaggcacgcgataaaacgctggggctggcaacactgtgcatt
ggcggcggtcagggaattgcgatggtgattgaacggttgaattaa

DBGET integrated database retrieval system