KEGG   Shigella sp. PAMC 28760: A0259_17900
Entry
A0259_17900       CDS       T04390                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
shq  Shigella sp. PAMC 28760
Pathway
shq00230  Purine metabolism
shq01100  Metabolic pathways
shq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A0259_17900
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AMR24385
Position
3614477..3614956
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcaccaggcacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgttggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system