KEGG   Shigella sp. PAMC 28760: A0259_18190Help
Entry
A0259_18190       CDS       T04390                                 

Definition
(GenBank) class II fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
shq  Shigella sp. PAMC 28760
Pathway
shq00010  Glycolysis / Gluconeogenesis
shq00030  Pentose phosphate pathway
shq00051  Fructose and mannose metabolism
shq00680  Methane metabolism
shq01100  Metabolic pathways
shq01110  Biosynthesis of secondary metabolites
shq01120  Microbial metabolism in diverse environments
shq01130  Biosynthesis of antibiotics
shq01200  Carbon metabolism
shq01230  Biosynthesis of amino acids
Module
shq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
shq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:shq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A0259_18190
   00030 Pentose phosphate pathway
    A0259_18190
   00051 Fructose and mannose metabolism
    A0259_18190
  09102 Energy metabolism
   00680 Methane metabolism
    A0259_18190
Enzymes [BR:shq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     A0259_18190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase S-methyl_trans MR_MLE_C
Motif
Other DBs
NCBI-ProteinID: AMR24438
Position
complement(3681149..3682228)
Genome map
AA seq 359 aa AA seqDB search
MSKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQ
FSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWI
DGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTG
GEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPT
ILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGV
LNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagatttttgatttcgtaaaacctggcgtaatcactggtgatgacgtacagaaa
gttttccaggtagcaaaagaaaacaacttcgcactgccagcagtaaactgcgtcggtact
gactccatcaacgccgtactggaaaccgctgctaaagttaaagcgccggttatcgttcag
ttctccaacggtggtgcttcctttatcgctggtaaaggcgtgaaatctgacgttccgcag
ggtgctgctatcctgggcgcgatctctggtgcgcatcacgttcaccagatggctgaacat
tatggtgttccggttatcctgcacactgaccactgcgcgaagaaactgctgccgtggatc
gacggtctgttggacgcgggtgaaaaacacttcgcagctaccggtaagccgctgttctct
tctcacatgatcgacctgtctgaagaatctctgcaagagaacatcgaaatctgctctaaa
tacctggagcgcatgtccaaaatcggcatgactctggaaatcgaactgggttgcaccggt
ggtgaagaagacggcgtggacaacagccacatggacgcttctgcactgtacacccagccg
gaagacgttgattacgcatacaccgaactgagcaaaatcagcccgcgtttcaccatcgca
gcgtccttcggtaacgtacacggtgtttacaagccgggtaacgtggttctgactccgacc
atcctgcgtgattctcaggaatatgtttccaagaaacacaacctgccgcacaacagcctg
aacttcgtattccacggtggttccggttctactgctcaggaaatcaaagactccgtaagc
tacggcgtagtaaaaatgaacatcgataccgatacccaatgggcaacctgggaaggcgtt
ctgaactactacaaagcgaacgaagcttatctgcagggtcagctgggtaacccgaaaggc
gaagatcagccgaacaagaaatactacgatccgcgcgtatggctgcgtgccggtcagact
tcgatgatcgctcgtctggagaaagcattccaggaactgaacgcgatcgacgttctgtaa

DBGET integrated database retrieval system