KEGG   Sarcophilus harrisii (Tasmanian devil): 100914408Help
Entry
100914408         CDS       T02286                                 

Gene name
MSS51
Definition
(RefSeq) putative protein MSS51 homolog, mitochondrial isoform X2
  KO
K17095  annexin A7/11
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
KEGG Orthology (KO) [BR:shr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    100914408 (MSS51)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100914408 (MSS51)
  Exosomal proteins of other body fluids (saliva and urine)
   100914408 (MSS51)
  Exosomal proteins of colorectal cancer cells
   100914408 (MSS51)
  Exosomal proteins of bladder cancer cells
   100914408 (MSS51)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin zf-MYND zf-C6H2 zf-Mss51
Motif
Other DBs
NCBI-GeneID: 100914408
NCBI-ProteinID: XP_003755141
Ensembl: ENSSHAG00000002036
UniProt: G3VGI9
Position
1
AA seq 843 aa AA seqDB search
MAPRRRRRKRSAPVASPQGALTPTVSGPSIDALGFLSLESNVPGLSQVILQKLNMKSYEE
YKAVVNGGTPGSGFGIRSLSDMFQRLEDTFQFCARCRVLPDQLPDCQLLRRCKRCRNVYY
CGPECQKADWPAHKKVCGELRLVAIDRLLEWLMVTGDLSLPSGPWPWPPEAVQDWDTWFS
MWGTQLDTMLESVLGSHAMSTLWDSVGRPRPDPDSLRGSLRRLLSDTLSQPLTLGLGLRT
LVGSTGKPGGITVHVVGASHVEAFLTSHRAYDELRHMFPGYAGLHIVMVGVDLAVESLPQ
LSSVLPSASGTIQLSSYQGLYHDFWEEQIETGRAVWPDLVAGFHPGFHASQDLMAGWLPT
LLLLRDYEIPTIFTVYRMSYPGYPPTGYPAFPGYPPAGQEASFPPPAGQYPYPTGFPPMG
GGAYPPAPTGGFPGPGGYPGYPASGGYPGAPPAGGAPSYPGASPGQGFGVPPGAPGFSGY
PQPPVQSYAGGPGQIQIPGGFPGGQVPSQYPSGQAPAPYPNQPAAMTQGTQGTIRPAANF
DAVKDAEILRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTMYGKDLIKDLKSELSG
NMEELILALFMPPTYYDAWSLRNAMKGAGTQERVLIEILCTRSNREIRDIVNCYRSEFGR
DIEKDIRSDTSGHFERLLVSMCQGNRDENQNVNHQLAQEDAQRLYQAGEGKLGTDESSFN
MVLATRSFPQLRATMDAYSRIANRDLLSSIGREFSGNVENGLKTILQCALNRPAFFAERL
YYSMKGAGTDDSTLVRIVVTRSEIDLAQVKQTFAQMYQKTLATMISSDTSGDYRRLLLAI
VGQ
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atggctcctcggcgaaggcgcaggaagcgctctgcaccagtggcttccccccaaggggct
ctgacccccacagtctcaggtcccagcattgatgcacttggctttctctctttggagagt
aatgtccctggcctatcccaggttatccttcagaagctgaacatgaagagctatgaggaa
tacaaggcagtggtgaatgggggaacccctgggtcaggctttgggattcgtagcctcagc
gacatgttccagcgcctggaagacaccttccagttctgcgcccggtgccgagtgcttcct
gaccaactccctgattgtcagctccttcgccgctgtaagaggtgcagaaatgtttactac
tgtggtcctgagtgccagaaggcagattggccggcacacaagaaggtctgtggggaactt
cggcttgtggctatagaccggctcttggagtggctcatggtcacaggtgacctctcctta
ccttcaggaccttggccatggccaccagaggctgttcaggactgggatacttggttttca
atgtgggggacacagctggatactatgctggaatctgttttgggtagtcatgcaatgtcc
accttgtgggacagtgtggggcggccacggccagacccagatagcctccggggctccctg
cgacggcttctctcagacaccctttctcagcccctgacattgggattagggctgcggaca
ttggtggggagtacggggaagccaggggggatcacagtgcatgtggtaggtgcctcccat
gtagaggctttccttactagccacagggcctatgatgagctcagacacatgtttcctgga
tatgctggcctccacatagtcatggttggtgtggacttggctgtggaatccctccctcag
ctttcctcagtcttaccctcagcttctggtacaattcagctcagcagctaccagggcctg
tatcatgacttctgggaagaacaaatagagacgggccgggcagtctggccagacttggta
gcagggtttcatccaggtttccatgccagccaagacttgatggctggctggctgcccacc
ctactgctgcttcgtgattatgagatccccactatcttcactgtctatagaatgtcttac
ccaggataccctcctacaggctacccagcattccctggatatcctcctgcaggtcaggag
gcatcttttccacctcctgctggtcagtatccttatcctactggctttcccccaatggga
ggaggtgcctatcctccagcaccaactggtggtttccccggaccaggaggttacccaggt
taccctgcttccggagggtatcctggtgccccaccagcaggaggagccccctcttaccct
ggagcttctccaggccaaggatttggagtcccaccaggtgcacctggtttttctggctac
ccacaacccccagtccaatcctatgctggtggaccaggacagatacaaatcccaggtggg
tttcccggaggacaagttccttcccagtatcctagtggccaagctcctgctccttaccct
aatcagccagcagccatgactcaaggtactcagggaaccatccgacctgctgccaacttt
gatgctgtaaaggatgcagaaattctccgaaaggccatgaaaggatttgggactgatgag
caagcaattgtggatgttgttgccaatcgctccaatgatcaaagacagaagattaaagca
gcttttaagaccatgtatggaaaggatttaatcaaagatctcaagtctgagttaagtgga
aatatggaagaattgatccttgctttgtttatgccacctacgtactatgatgcttggagt
ttacggaatgcaatgaagggagcaggaactcaagaaagagtactgattgagattttgtgc
acaagatcaaatcgggaaattcgagatattgtcaactgttaccgatcagaatttggacga
gatattgaaaaagacattcgatcagatacctcaggccactttgaaagactgctagtatcc
atgtgtcagggtaatcgtgatgaaaaccagaatgtaaatcatcagctggctcaggaagat
gctcagcgtctttatcaagctggggaagggaaattgggaactgatgaatcctctttcaac
atggttcttgccacaagaagcttccctcagttaagagctaccatggacgcctattccaga
attgctaatcgagatttgttaagcagcattggcagagagttttctggaaatgtagaaaat
ggtttgaagacaatcttgcagtgtgccttgaaccgtccagccttctttgctgagcggctc
tactactccatgaaaggggctggcacagatgattcgacccttgtgaggatcgttgtcacc
cgaagtgaaattgatcttgcgcaagtgaagcagacatttgcacagatgtatcagaagacc
ctggcaacgatgatctccagtgacaccagtggggactatcgccgcctgctcctggccatt
gtgggccagtag

DBGET integrated database retrieval system