KEGG   Sarcophilus harrisii (Tasmanian devil): 100914711Help
Entry
100914711         CDS       T02286                                 

Gene name
HLCS
Definition
(RefSeq) biotin--protein ligase isoform X3
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00780  Biotin metabolism
shr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    100914711 (HLCS)
Enzymes [BR:shr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     100914711 (HLCS)
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     100914711 (HLCS)
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     100914711 (HLCS)
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     100914711 (HLCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_LplA_LipB BPL_C BPL_N
Motif
Other DBs
NCBI-GeneID: 100914711
NCBI-ProteinID: XP_003763443
Ensembl: ENSSHAG00000009880
Position
3
AA seq 715 aa AA seqDB search
MENRLQMDNGMVPQKIVSVHLQDSVLKELQQLTVSKITEVEEFKIKPEMIEPLIDRNDQK
VQNEEYNQKKGSACQEEPTNASEKGAEFDEYHHLHLSSCHECLELESSTIESVRFASAED
IPDLPYDFSSSQEGSVDTTCQTVQNIPGKPPNILLFVGSDCQKVQQRFQQLHSILMDCLD
TDCYIIYHLKEKNVLSDPWVHNCLLLIIATEEPISEAVYQKFMVYLSQGGKVLGLSSSFT
FGGLQLKSKEELKKSIQTLVFSKADDSEMKLNVVTSGILFEEGTGELPSHPGKLKGYLEN
LDRDRMIVHLPFGTNGGEAILCQVHLEMSPNTLIETQDAFNLLKSSNFMRFEVLKEILTV
LGLSCELKKIPPLTPLYLLTADEEVRISFMQWLTRNVGPEGVMKFRKLTLKFVSSYKPEL
EVTPSHMPVITATEDFAPEHFNLEIYQKNLHTKQLGKIILFAEVTSSTMNLLDGLMFEVP
PDLGLVAIAAQQTQGKGRDGNVWLSPIGCSLSTLHLQIPLYSHLGQRIPFVQHLMSLAVV
QAVRSIPEYEDINLRVKWPNDIYYSDQMKLGGVLVNSTLMGTTFHILIGCGINVNNSNPT
ICINDLIIEYNKKYNKNLSLLHVDYLVARTITVLESLIDAFQDKGPNAILPLYYKYWIHS
GQQVHLGKDEGPLVWIVGIDDSGFLQVHQEGGDVMTVHPDGNSFDMLKNLIIPKN
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacagactccaaatggataatggaatggtgccacaaaagattgtctctgtacat
cttcaggactcggtgctaaaagaactacagcaattgacagtatccaagatcacagaagtg
gaggaatttaaaatcaaaccagaaatgatagagcctttaatagataggaatgaccaaaag
gttcaaaatgaggagtataatcagaagaaaggcagtgcttgtcaggaagaacccaccaat
gcatcagaaaaaggagctgaatttgatgaataccatcatttacatctttcaagttgccat
gaatgtttggaactagaaagcagcaccattgaatcagtaagatttgcatctgcagaagac
attccagatcttccttatgatttcagcagcagccaagaaggcagtgttgataccacttgc
caaactgtacaaaatattcctgggaagccaccgaatattttactctttgtgggctctgac
tgtcagaaagtacagcaaagattccagcagctccattccattctgatggattgtcttgac
actgattgttatataatctatcacctgaaggagaagaatgtgctcagtgatccatgggta
cataactgtttgttgttgatcattgccacagaagagcctatttctgaagcagtttaccaa
aagttcatggtgtacctgtcccaaggtgggaaggttttggggctgtcttcctcctttaca
tttggtggcctacagctgaaaagcaaagaggaactaaagaagagcattcagacattggtt
ttttccaaggctgatgacagtgaaatgaaactgaatgtagtgacgagtgggatcctgttt
gaagaaggcactggagagctgcctagccatcctggaaagctcaagggttacttagaaaac
ttggatagagacaggatgattgttcatctgccttttggaacaaatggaggagaagcaatt
ctttgtcaggtgcacttggaaatgtctcccaacactttaatagaaactcaagatgccttt
aatttattgaaatcaagcaatttcatgagatttgaagtccttaaagagatcctgacggtc
cttggcttaagttgtgaattaaagaaaattcctcccctgactcctctttatttgctcaca
gctgatgaggaagtccgaatttcttttatgcagtggctcacaagaaatgtgggacctgaa
ggagtaatgaaattcaggaagctgacccttaaatttgtttcatcctataaaccagaattg
gaagtaaccccatctcatatgccagttatcactgctacagaggattttgccccagaacat
tttaacctggagatctatcaaaaaaatttgcatacaaagcaactaggaaaaataattctg
tttgctgaagtgacttcatccacaatgaatcttctggatgggttgatgtttgaggtgcca
ccagacctcggtttagtagcaattgcagcccagcaaacacaaggaaaaggtcgtgatggg
aatgtctggcttagtcctataggatgttctctttctaccttacaccttcaaatcccctta
tattctcatctgggtcagagaattccatttgttcaacacttgatgtctttggcagtggtg
caggcagttcgatcaattcctgaatatgaggatatcaatttaagagtaaagtggcccaat
gatatctactacagtgatcaaatgaagcttggcggagttttggtcaattcaacacttatg
ggaacaacttttcatattcttattggctgtggaattaatgtgaataacagtaaccctact
atttgcatcaatgatctcatcatagaatataataagaaatataataaaaacctcagtctg
ttacatgtggattatcttgttgcaagaacaataactgtactggagagcctaatagatgca
tttcaggacaaaggacctaatgcaattcttcctctatattacaaatactggatacacagc
ggtcagcaagtccatctgggaaaagatgagggccctttggtgtggattgttggaattgat
gattctggcttccttcaagttcatcaagaaggaggtgatgttatgactgtgcatccagac
ggcaactcttttgacatgctgaaaaaccttatcatccccaagaattaa

DBGET integrated database retrieval system