KEGG   Sarcophilus harrisii (Tasmanian devil): 100914733
Entry
100914733         CDS       T02286                                 

Gene name
NR2E1
Definition
(RefSeq) nuclear receptor subfamily 2 group E member 1
  KO
K08545  nuclear receptor subfamily 2 group E member 1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
KEGG Orthology (KO) [BR:shr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100914733 (NR2E1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:shr03310]
    100914733 (NR2E1)
Transcription factors [BR:shr03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100914733 (NR2E1)
Nuclear receptors [BR:shr03310]
 2. Hepatocyte nuclear factor 4 like
  2E. Tailless like receptor
   100914733 (NR2E1)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100914733
NCBI-ProteinID: XP_003769385
Ensembl: ENSSHAG00000017854
UniProt: G3X050
Position
4
AA seq 385 aa
MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQGGC
PVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEENGAAPHF
PSAALPAPAFFTAVTQLEQHNLELAAVSGTPERQTLVGLAQPTPKYPHEVNGAPMYLYEV
ATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDAN
TLLAVSGMNGENTDSQKLSKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTH
SGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEE
VFFKKTIGNVPITRLLSDMYKSSDI
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgagcaagcccgcgggatcaacaagtcgcattttagacatcccgtgtaaagtgtgtggg
gatcgcagctctggaaagcactatggagtatatgcttgtgatggatgctcggggtttttc
aaacggagtatcaggaggaatcggacgtatgtctgcaaatctggaaaccagggtggctgc
ccagtggataagacgcacagaaaccaatgcagagcttgtcgcttgaagaagtgtttggaa
gtcaacatgaacaaagatgctgtgcaacatgagcgaggacccaggacatctactatccgc
aagcaagtggccctgtatttccgcggccacaaggaggagaacggcgcagcccctcacttc
ccttccgcagctctgcctgccccagctttcttcacagcagtcacgcaattggagcaacat
aacctggagctggcggcggtgtccggtaccccagagaggcaaacgttggtggggctggcc
cagcccacacccaagtatcctcatgaggttaatggagcccccatgtatctctatgaagtg
gccactgagtctgtatgtgaatcagcagccagactccttttcatgagcattaaatgggcc
aagagtgttccagccttctccactctgtccttgcaagatcagctgatgcttttggaagat
gcttggagagaactgtttgttctaggaatagcacaatgggccattccagttgatgctaac
actctactggctgtatctggcatgaatggtgaaaacacagattcccagaagctgagtaag
atcatctctgaaatccaggctttgcaggaggtagtggccagattcagacaacttcggctg
gacgcaactgaatttgcctgtctcaaatgcattgtcactttcaaagctgtacctacacac
agtggttctgaactgagaagtttccggaatgccgcagccattgcagcacttcaagacgaa
gcacagctaacacttaacagttatatccacaccaggtatcccactcaaccttgtcgattt
gggaaactcctgttgcttctgccagccttacgctccattagcccatctacaatagaagaa
gtgtttttcaaaaaaaccattggcaatgtgccaattacgagactgctttcagatatgtac
aaatccagtgatatctaa

DBGET integrated database retrieval system