KEGG   Sarcophilus harrisii (Tasmanian devil): 100914771
Entry
100914771         CDS       T02286                                 

Definition
(RefSeq) interferon regulatory factor 4-like isoform X2
  KO
K09445  interferon regulatory factor 4
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:shr00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100914771
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100914771
Transcription factors [BR:shr03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    100914771
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 100914771
NCBI-ProteinID: XP_003757081
Ensembl: ENSSHAG00000012864
UniProt: G3WI18
Position
2
AA seq 423 aa
MAEPGGPLRLRDWLVAQIESGSYPGLRWENREKTMFRIPWKHAAKQDYREQQDAALFRAW
AIYKGKYQEGTDKADPSVWKTRLRCALNKSTSFQEVIDRSQLYISEPYKVYQITSKETCN
LEDEGQKGHLKTPKDLSTEPLQQPDQADSDSDEETGKERISKGCHQVSPAPCFTSPKAES
DYQVTGTFYSWDPSQSHLPLSLTSYENVSTSDCWLHIRLYYRDILVKEAIAHTAEGCRLT
TQPVPMDSPHLYGPARLEQIQFPSPKALPGTSPLVTQILERLLPHLDRGVLLWVAPEGVF
AKRQCQGRVYWRGPLAPHCNQPNKLEREKTYKLLDTQQFLDQLRRHLCLGEPAPQYQIQL
CFGEEYPGPAGQSRGRLIMAHVEPVFARELFLRSRRLSPQGPPGSQPSAAENVARILNQP
SQP
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggcagagccaggcggccccctgcgtttgagggactggctggtggctcagattgaaagc
ggtagctatcccggactccgctgggaaaaccgggaaaaaactatgttccgcatcccctgg
aagcacgcggccaagcaggactacagggagcagcaggacgccgcgctctttcgggcctgg
gccatttacaaaggtaagtaccaggaaggcacagacaaagctgatccatctgtctggaag
acccgtctgcgctgtgccctcaacaagagcacatccttccaagaagtgattgatcgcagc
caactgtacatctctgaaccctacaaggtctaccagatcacctccaaggaaacctgcaac
ctggaggatgaggggcagaagggccatctgaaaacccccaaagatctatcaactgagcct
ctccagcagccagaccaggctgactcagactcagatgaggaaactggcaaagaaaggatt
tccaagggctgccatcaagtttccccagccccctgtttcaccagcccaaaggctgagtct
gattaccaagtgacaggcacgttttacagttgggacccttcgcagagtcaccttcctcta
agcttgacttcctatgagaatgtcagcacttctgactgctggctccacatccgtctgtac
taccgagatatcctggtgaaggaggccattgctcacactgctgagggctgccgcttgaca
acccagcctgtgcccatggacagcccacatctctatggccctgccagacttgagcagatc
cagttcccatcacctaaagctctgccagggaccagcccacttgtcacccagattctggaa
cgccttttgcctcacctggacaggggagtcctgctctgggtagctcctgaaggagtcttt
gctaagaggcagtgccagggtcgagtttactggcgaggccctctggcacctcattgtaac
cagcccaacaaattggaaagagagaagacctataagctgttggatactcagcagttcctg
gatcagctacgtcgacacctatgtcttggggagcctgcaccccagtaccaaatccaactg
tgctttggagaggagtacccaggtccagctggccaatcccgagggagactcatcatggct
catgtagagcctgtgtttgccagagaactcttcttgcgctccaggcgtctcagtccccaa
ggccctccaggctcccagcccagtgctgcagagaacgtggcccgcattctgaaccagcca
agccaaccctga

DBGET integrated database retrieval system