KEGG   Sarcophilus harrisii (Tasmanian devil): 100915906Help
Entry
100915906         CDS       T02286                                 

Gene name
THNSL2
Definition
(RefSeq) threonine synthase-like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
KEGG Orthology (KO) [BR:shr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100915906 (THNSL2)
Enzymes [BR:shr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     100915906 (THNSL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 100915906
NCBI-ProteinID: XP_023351017
Ensembl: ENSSHAG00000010329
Position
1
AA seq 478 aa AA seqDB search
MRYVSTRGGSPSVDFEGALFSGYAPDGGLFMPEEIPKLDRETLKQWSTLSYPDLVIELCS
LFIDPELIPKKDLKVLVDRAFSRFRHRDVVHLSRMKNGLNVLELWHGVTYAFKDLSLSCT
GQFLQYFLEKRQKHVTIVVGTSGDTGSSAIESVRGAKNMDIIVLLPLGRCSKIQELQMTT
VIEENVHVFGVDGNSDELDEPIKDVFADVAFAKKHNLMSLNSINWSRVLVQMAHHFFAYF
QCVPSMDICPLPTVEVVVPTGAAGNLAAGCIAREMGLPIRLVAVVNQNDIIHRTVQKGDF
SLSGITRLTLASAMDIQVPYNMERIFWLLSGSHSGLLRALMEQFDRTKNLCLPRKLHVKV
SETISSLSASDEDVIQTMQRCWEENHYLLCPHSAVAVSYHYQQLASEQPSLPRCCLAPAS
AAKFQDAVLQAQLVPEIPRDIQALEHMKTRCTPLRRGDDWTQQLRNKIEDLSQQRRGP
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaggtacgtcagtacccggggaggaagccccagtgttgactttgaaggagccttgttc
tcaggctatgcccctgatggggggctcttcatgcctgaagagatccccaagctggacagg
gagaccctgaaacaatggagcaccctctcctaccctgacctggtgatcgagctgtgctct
ctcttcattgacccagagctcattccaaagaaagacttgaaggttctggtcgaccgagcc
ttcagcaggttccgacacagagatgtcgttcacctgagcaggatgaagaatggactgaat
gtgctggaactgtggcacggtgtcacctacgccttcaaggacctgtctctgtcctgtaca
ggacagttcttacagtactttctggagaaaaggcagaaacatgtaactattgtcgtaggg
acttctggagacaccgggagctcagctatagaaagtgtccgtggagccaaaaatatggac
atcattgttttgttgcctctgggacgttgctccaagatccaggaactccagatgaccaca
gtgattgaggagaatgtgcatgtatttggggtggatggtaacagcgatgagctggatgag
cccatcaaagatgtgtttgcggatgtggcttttgccaagaagcataacctgatgagtctg
aactccatcaactggtcccgggtccttgtgcagatggctcaccatttctttgcctacttc
cagtgtgtgccctccatggacatctgccccctccccactgtggaggtggttgtgccgaca
ggggctgcgggcaatctggcagcgggctgcattgcgagggagatgggcctgcccatccgt
ctggttgcagtggtgaaccagaatgacattattcaccggactgtccagaagggggacttc
tcactctcaggaatcaccagactgaccttggcatcagccatggacatccaggtgccctat
aacatggagaggattttctggctgctctcgggctcacacagcgggctgctcagggccctc
atggagcaatttgacagaaccaagaatctgtgtttgccaagaaagctccacgtcaaggtt
tcggagacgataagctccctgtcggcttcagacgaggatgtcattcaaaccatgcagcgg
tgctgggaggagaaccactacctgctctgtccacactcagccgtggctgtctcctaccac
taccagcagctggcctctgaacagcccagcttgcccagatgctgcctggcccccgcctcg
gctgccaagttccaggacgccgtcctccaagcccagctggtccccgagattcccagagac
atccaagcgctggagcacatgaagactcggtgtactccccttcggagaggcgatgactgg
acccagcagctccgcaacaagattgaggacctttcccagcagaggagggggccgtga

DBGET integrated database retrieval system