KEGG   Sarcophilus harrisii (Tasmanian devil): 100915999Help
Entry
100915999         CDS       T02286                                 

Gene name
PRLR
Definition
(RefSeq) prolactin receptor
  KO
K05081  prolactin receptor
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04060  Cytokine-cytokine receptor interaction
shr04080  Neuroactive ligand-receptor interaction
shr04151  PI3K-Akt signaling pathway
shr04630  Jak-STAT signaling pathway
shr04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100915999 (PRLR)
   04151 PI3K-Akt signaling pathway
    100915999 (PRLR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100915999 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    100915999 (PRLR)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    100915999 (PRLR)
Cytokine receptors [BR:shr04050]
 Interleukin receptor families
  Prolactin receptor family
   100915999 (PRLR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EpoR_lig-bind IL6Ra-bind fn3
Motif
Other DBs
NCBI-GeneID: 100915999
NCBI-ProteinID: XP_003759994
Ensembl: ENSSHAG00000008641
Position
2
AA seq 629 aa AA seqDB search
MEENTKNATQVNPKGQSAPGKPKIEKCRSPEKETFTCWWKPGSDGGIPTNYTLFYRKEGE
SLTHECPDYKTGGPNSCYFNKKHTSIWMVYIIWVNATNQMGKSMSDPRYVDVTYIVEPDP
PLNLTLEVKQPEDGKPYLWLKWSPPAMVDVRSGWLTLQYELRLKPEKAAEWETHFAGQQT
QFKIFSLYLGQKYLVEVRCKPDHGSWSQWSPQSSILIPSDVKMKDTTVWIFVAVLSSIVC
LIIVWTMALKGYSMITCLLPPVPGPKIKGFDTHLLEKGKSEELLSALGCQGFPPTSDCED
LLVEFLEVDDNEDQQLMPTHVKDHPSQGMKPTHLDPDSDSGRGSCDSPSLLSEKCEEPRV
PPPTFPIPEVNEKPEDPGTKMTHSWDPQPQGINLEGKIPYFSAIGSKSSTWPMPQQSSNH
NLRSSYHNIADICKVALGTVNAPAVSLKKEENQALNYSTTIDTVGKGATDKQNELEHFHS
KADQDSTWLLPKEKMPFMSPRPMDYVEIHKVNKDGALSLLPKQKESSVHGEQAGTPDTSK
EYTKVSRVMDNNILVLMQDPRAQAAMTFEESAKETPQPLPHNQAEKNLSYCTSSPGDCRL
QTENVKQQPPVFSGKLERIIAIVCSVLFL
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaaataccaagaatgctacacaggtcaacccaaaaggacaatcagcccctgga
aagcctaagatcgaaaagtgtcgttctcctgaaaaggaaacattcacttgctggtggaaa
ccaggatcagatggaggaattcctaccaactatactttgttttacagaaaagaaggagag
tcactcacccatgaatgtcctgactacaaaactggaggtcctaattcctgttattttaac
aagaagcacacctctatatggatggtctacatcatctgggtcaatgctactaaccagatg
ggaaagagtatgtcagatccacgttatgtggatgtgacttacatagttgaaccagaccct
cctttgaacttaactttagaagttaaacaaccagaagatggaaaaccctatctgtggttg
aagtggtctccacctgccatggttgatgttaggtctggttggctcacacttcagtatgaa
ttgcgactaaaacctgagaaagcagcagagtgggagacacattttgctggtcagcagaca
cagtttaaaatcttcagcttgtacctgggacagaaataccttgtagaggttcgctgtaaa
ccagaccatggctcttggagtcagtggagccctcaaagttcaattctgatacccagtgat
gttaaaatgaaagatacaacagtgtggatctttgtggctgttctctcatctattgtttgt
ctgattatagtctggacaatggctctgaaaggttacagcatgatcacctgcctcctgcca
cctgtcccaggccccaaaataaaaggatttgatactcatctgctagaaaaagggaagtct
gaagaactcctgagtgccttgggatgccagggctttcctcccacttcagattgtgaggat
cttctggtggagtttctggaagtggatgacaatgaggatcaacagctaatgcccacccat
gtaaaggaccatcctagccaaggcatgaagcctacacaccttgacccagacagcgactcc
ggcaggggaagctgcgatagcccttccctcttgtctgagaaatgtgaagaaccccgggtc
cctccaccgaccttccccattccagaggtcaatgagaagccagaggatcctggaacaaaa
atgacccacagctgggacccacaaccccagggcataaacttggaaggcaaaatcccctat
ttcagtgccattgggtccaagtcttcaacatggcccatgccccagcaatccagtaaccac
aacctgcgatcttcttaccacaacattgccgacatttgtaaggtggccctgggcactgtg
aatgctccagctgtctcactgaagaaagaagagaatcaagctttaaattactcaacaact
attgacacagtggggaaaggagcaacagataagcagaatgagttggaacacttccactcc
aaggctgaccaagattccacatggctgctacccaaggagaaaatgccttttatgtctccc
aggcccatggattatgtggagattcacaaagtcaacaaggatggcgccttatcgttgctc
ccgaaacagaaagaaagcagtgttcatggggaacaggccggcactcctgacaccagtaag
gagtacaccaaagtgtccagggttatggacaataacatcctggtgctgatgcaagaccca
agagctcaggccgccatgacatttgaagaatctgctaaggaaactcctcagcccctacca
cacaaccaagctgagaaaaacctgtcctactgcacctcttccccaggtgactgcagactc
cagactgaaaatgtcaagcagcagcctcctgtgttcagtggcaaattagaaagaattatt
gcaatagtttgctcggtcctctttttgtaa

DBGET integrated database retrieval system