KEGG   Sarcophilus harrisii (Tasmanian devil): 100916604Help
Entry
100916604         CDS       T02286                                 

Gene name
EGR3
Definition
(RefSeq) early growth response protein 3
  KO
K12497  early growth response protein 3
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04625  C-type lectin receptor signaling pathway
shr05161  Hepatitis B
shr05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    100916604 (EGR3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100916604 (EGR3)
  Infectious diseases
   05161 Hepatitis B
    100916604 (EGR3)
Transcription factors [BR:shr03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    100916604 (EGR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 DUF3446 zf-C2HC_2 zf-met zf-BED zf-C2H2_6 Zf_RING zf-H2C2_5
Motif
Other DBs
NCBI-GeneID: 100916604
NCBI-ProteinID: XP_023350538
Position
1
AA seq 386 aa AA seqDB search
MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSSLNLFSGSSDAVAHYNQMATENVMDIGLA
NEKPNQELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGAL
STQTSTASMVQPQGEVEPMYPALPPYSNCSDLYSEPVSFHDPQGNPGLAYSPQDYQSAKP
GLDSNLFPMIPDYNLYHHPNEMGSVTDHKPFQSMDPIRVNPPPITPLETIKAFKDKQIHP
GFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHTG
HKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKEK
KAEKGGAASASSAPPVSLAPVVTTCA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcaaactcgccgagaagctgccggtgaccatgagcagtttgctaaaccaactg
cctgacaatctgtaccccgaggagatccccagctctctcaacctcttctccggcagcagc
gacgcggtggctcattacaaccagatggctacagagaatgtgatggacatcggtctggcg
aacgagaagcccaaccaggaactctcttactccggctccttccagcccgctccgggcaac
aagacggtgacctacttggggaagttcgccttcgattccccttccaactggtgtcaggac
aacatcatcagcctcatgagcgccggcatcctaggggtgcccccggcctccggggcgctc
agtacacagacctctaccgccagcatggtgcagccgcagggcgaggtggaacccatgtac
ccggcgttgcccccttactccaactgcagcgacctctattctgagcccgtgtcttttcat
gaccctcagggcaaccccgggctcgcttattccccccaggattaccagtcggccaagccc
ggtttggacagtaaccttttccccatgatccccgactacaacctgtaccaccaccccaat
gagatgggatccgtcacggaccacaagccgttccagagtatggatcccatccgggtcaat
ccgccccccatcacccctctggagaccatcaaggctttcaaggacaaacagatccaccct
ggcttcggcagcttgccccagccgccgctcactctcaagcccatccggccccgcaagtac
cccaatcgacccagcaagaccccgctccacgaacgaccccacgcgtgtccggccgagggc
tgcgaccgccgcttcagccgctcagacgagctgacccggcacctgcgtatccacaccggc
cacaagcccttccagtgccggatctgcatgcgcagtttcagccgcagcgaccacctcacc
acccacatccgcactcacacgggcgagaagcccttcgcctgcgagttctgcgggcgcaag
ttcgcgcgcagcgacgagcgcaagcgccacgccaaaatccacctcaaacagaaggagaag
aaggcagagaaggggggagcggcctccgcctcctcggcgccccctgtatctctggctccc
gtcgtcaccacctgcgcctga

DBGET integrated database retrieval system