KEGG   Sarcophilus harrisii (Tasmanian devil): 100917112Help
Entry
100917112         CDS       T02286                                 

Gene name
EIF3A
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr03013  RNA transport
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100917112 (EIF3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:shr03012]
    100917112 (EIF3A)
Translation factors [BR:shr03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    100917112 (EIF3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 100917112
NCBI-ProteinID: XP_012396394
Ensembl: ENSSHAG00000001347
Position
1
AA seq 1367 aa AA seqDB search
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTEAAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLTQEEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLG
LQAPPTRIVLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCDRVTKVLNWVRDQAEK
EPELQQYVPQLQNNTILRLLQQVAQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDL
QVRIDHTSRTLSFGSDLNYSTREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPA
HVLQEKEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAE
LQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRVK
DMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVERLKAARQSVYEEKLKQFE
ERLAEERRNRLEERKKQRKEERRVTYYREKEEEEQRLAEEQMLKEREERERAEREKREEE
QREYQEHVKKLEEVERKKRQREMEIEERERRREEERRIADDSLSRKDTRWGDRDSESTWR
RGPEVESEWRRPPEKEWRRGEGRDEERSLRRDEDRPRRAADDEERDSLRTDEDRIPRRGM
DDDRPLRRGADDDRFPRRGADDDRVWRNTEDDRPPRRSLDEDRGTWRSADDDRPPRRGLD
DDRGSWRTADEDRGPRRGIEDDRGPRRGLDEEKSSWRNADDDRGPRRGMDDDRGPRRGMD
DDRGPRRGMDDDRGPRRGMDDDRGPRRSMDDDRGPRRNADDDRISRRGDDDRGTWRNMDD
DRLSRRGEDDRIPRRGEDSRPGLWRPVGKPGGWREREKAREESWAPPRDSRPSEDREWDR
DKERDRDQDREENDKEHERERDGDREDRFRRSRDETGWRRPAEEASSWRDSNRRDEWDRD
DRRGRDRDERGGRDLRDRRDDRDRRGPLRSEREETSSWRRTEERKDERAEERETPRRIPP
PLSRDREREGEKESRGSWRTEKDRETRESLRRTKNETDEDGWTTVRR
NT seq 4104 nt NT seq  +upstreamnt  +downstreamnt
atgccggcctatttccagaggccggaaaacgccctcaaacgggccaacgaatttctcgaa
gttggcaagaagcagcccgcccttgatgttctctatgatgttatgaaaagtaaaaaacat
cggacatggcaaaaaatacacgagcctattatgctaaaatacctagaactatgcgtggac
ctccgcaagagccacctggctaaggaaggattatatcagtacaaaaatatttgtcaacag
gttaacatcaaatccttagaggatgtagttagggcatacttgaagctggctgaagaaaaa
actgaagctgctaaggaagaatcacaacaaatggtcttagatatagaagacttggataat
attcaaacacctgagagtgttctcctaagtgctgtaagtggtgaagatactcaggaccgt
actgacagattgcttttaactccctgggttaaatttttatgggagtcatatcgacaatgt
ttggaccttcttcgaaataattctagagtagagcgtctctaccatgatatcgcccagcaa
gctttcaaattctgcctccagtatactcgtaaggctgagttccgtaagctatgtgacaat
ctaaggatgcacttgtcacagatccaacgccaccacaaccaaagtacagccataaatctt
aataatcctgagagccagtctatgcatctggaaaccagacttgtacaattggacagtgct
ataagtatggaattgtggcaggaagcgttcaaagcagtagaagatattcatggtttattt
tcattatctaaaaagccacctaaacctcagttgatggcaaattactataacaaagtttcg
actgtgttttggaaatctgggaatgctctttttcatgcatctaccctccaccgactttac
catctgtctagagaaatgagaaagaatcttacccaagaagaaatgcagagaatgtcaact
agagttcttttagccacactctccattcctattactccagagcgtactgatattgctcga
cttctggatatggatggcatcatagttgaaaagcaacgtcgccttgcaacactgttaggt
ctccaggctccaccaacacgaattgttcttattaatgatatggttagattcaacgtatta
caatatgttgttccagaagtgaaagatctttataattggctggaggtggaattcaatcca
ctaaagctttgtgatcgggttacaaaggttctaaattgggtgagagatcaagctgaaaaa
gaacctgaattacaacaatatgttccacaactgcaaaacaacactattctccgacttcta
cagcaggtggcacagatatatcagagcattgagttctctcgtctgacttctctggttcct
tttgttgatgctttccaactggaacgtgctattgtagatgcagccagacattgtgatttg
caagttcgtattgatcatacttcaagaacattaagttttggatctgatttgaattattct
actcgagaagatgctccaattggtcctcatcttcaaagtatgccatctgagcagataaga
aatcagctgactgctatgtcttccgtgcttgccaaggcattggaagttattaaacctgct
catgttttgcaagaaaaggaagaacagcatcagttggctgtcactgcttatcttaaaaat
tcgagaaaagaacatcagcgcatcttggctcgccggcagacaattgaggagaggaaggag
cggcttgagagtttgaatattcagcgtgaaaaagaagagttggagcagcgcgaagcagaa
ctgcagaaagtgcggaaagctgaggaagaacgactccgccaggaagccaaggaaagggaa
aaagaacgcatcttacaggagcatgaacaaatcaaaaagaagactgtccgtgagcgactt
gagcaaattaagaaaacagaacttggtgccaaagctttcaaagatatcgatattgaggac
cttgaagaattggatccagatttcattatggccaagcaggttgaacaactagagaaagaa
aagaaagaacttcaggaacgcctgaaaaaccaggagaaaaagattgactactttgaaaga
gcaaaacgattagaagaaatacctcttataaagagtgcctatgaagaacagagagttaaa
gatatggacctttgggaacaacaggaagaagaaagaattactactatgcaactggaacgc
gaaaaagcccttgaacataagaatcgaatgtcaagaatgctggaagatagagatttattt
gtagagagactcaaggcagcaagacaatctgtttatgaggaaaaacttaaacagtttgaa
gaaagactggcggaagaaagacgtaatcgcttggaagaacggaagaaacagcgcaaggag
gaacgccgtgtgacttactaccgggaaaaggaagaggaggagcagcgcctggctgaagag
cagatgctcaaagagcgtgaagagagggagcgtgctgaacgtgaaaaacgtgaggaagaa
caacgagaatatcaggagcatgtcaagaaactagaagaagttgaaaggaaaaaacgccag
agagagatggaaattgaagaaagagaacgtcgtcgagaagaagagaggaggatagctgat
gattcactttccagaaaggatactcgttggggtgatagagattctgagagcacttggaga
agaggtcctgaagtagaatcagaatggagacgaccaccagaaaaggaatggcgccgggga
gaaggtcgtgatgaggagaggtctcttcgaagagatgaggaccgaccaagacgtgcagca
gatgatgaagagagagactctctaagaacagatgaagaccgcattccacgacgtggtatg
gatgatgataggccccttcgacgtggtgctgatgatgacagattccctcgtcgtggggct
gatgatgacagagtttggcgtaatacagaagatgatcgacctcccagacggagtttggat
gaagacaggggaacatggcgttctgcggatgatgatagaccgcctaggcgaggactagat
gatgatagaggaagttggcgaacagctgatgaggacaggggtcccaggcgtggaattgag
gatgatagaggacctaggcgtggtcttgatgaggaaaagtcatcttggcgcaacgcagat
gatgataggggtcctagacgtggcatggatgacgataggggtcctagacgtggcatggat
gatgataggggtcctaggcgtggcatggatgatgataggggtccaaggcgtggcatggat
gacgataggggtccaaggcgtagcatggatgatgatagaggacctcggagaaatgcagat
gatgatagaatttccaggcgtggagatgatgataggggaacttggcgtaatatggatgat
gatagactctctagacgtggtgaagatgaccgaattcccaggcgtggtgaagattcaaga
cccggtctttggagaccagttggcaagccaggtggctggagagagagagaaaaagcacga
gaggaaagctgggctccacctcgagattctaggccctcagaagaccgtgaatgggatcga
gacaaagaaagagatagagatcaagaccgtgaagaaaatgataaagaacatgaaagagag
agagatggcgatcgtgaagatcgtttcaggcgatctagagatgagactgggtggagaaga
ccagctgaggaagcttcaagttggagagattcaaatcgccgtgatgaatgggatagagat
gatcgtcgtggtcgtgacagagatgagaggggaggaagagacttgagagatcggcgagat
gatagagacagaagagggcccctaaggagtgagcgggaagaaacaagctcctggagacgc
actgaggaaaggaaagatgaacgggctgaagaacgtgagactcctcgtcgaattcctcct
cctctttccagagatcgagaaagagaaggtgaaaaggagagcaggggttcatggagaaca
gaaaaagatcgagaaactcgagaatctcttcgtcgaaccaaaaatgagactgatgaagat
ggatggaccactgtacgacgttaa

DBGET integrated database retrieval system