KEGG   Sarcophilus harrisii (Tasmanian devil): 100917511Help
Entry
100917511         CDS       T02286                                 

Gene name
MTMR4
Definition
(RefSeq) myotubularin-related protein 4 isoform X1
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00562  Inositol phosphate metabolism
shr01100  Metabolic pathways
shr04070  Phosphatidylinositol signaling system
shr04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100917511 (MTMR4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100917511 (MTMR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100917511 (MTMR4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:shr01009]
    100917511 (MTMR4)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100917511 (MTMR4)
    3.1.3.64  phosphatidylinositol-3-phosphatase
     100917511 (MTMR4)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     100917511 (MTMR4)
Protein phosphatases and associated proteins [BR:shr01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    100917511 (MTMR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE Y_phosphatase DSPc Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 100917511
NCBI-ProteinID: XP_023357913
Ensembl: ENSSHAG00000010209
Position
4
AA seq 1214 aa AA seqDB search
MSLTARVSCSMLSCFGEEGPPSLEYIQAKDLFPPKELVKEEENLQVPFTVLQGEGVEFLG
RATDALIAISNYRLHIKFKDSVINVPLRMIDSVESRDMFQLHIACKDSKVVRCHFSTFKQ
CQEWLSRLSRATARPAKPEDLFAFAYHAWCLGLTEEEQHTHLCQPGEHIRCRQEAELVRM
GFDLHNVWRVSHINSNYKLCPSYPQKLLVPVWITDKELENVASFRSWKRIPVVVYRHLRN
GAAIARCSQPEISWWGWRNADDEYLVTSIAKACALDPGVRAAGGVPFNGNSEGSETCDAD
FDSSLTACSGVESTGAPQKLLILDARSYTAAVANRAKGGGCECEEYYPNCEVVFMGMANI
HSIRNSFQYLRAVCSQMPDPSNWLSALESTKWLQHLSVMLKAAVLVSNTVDREGRPVLVH
CSDGWDRTPQIVALAKILLDPYYRTLEGFQVLVETDWLDFGHKFGDRCGHQENAEDQNEQ
CPVFLQWLDSVHQLLKQFPCLFEFNEAFLVKLVQHTYSCLYGTFLANNPWEREMRNIYKR
TCSVWSLLRAGNKNFHNFLYVPGSELVLHPVCHVRALHLWTAVYLPASSPCTLGEDSMDL
YLPPVSQSQEFTGRSLDRLPKTRSMDDLFSACDTSSALTRTSSDPNLNNHCQEARAGLEP
WHSNSEGTDIPLAEHGPGSPQQPLEELGHHLQPSNQKDCLSNNTLNNHKNYPPSYKLLNS
MVLQQAKSHPSNPEIKDLEETKDSEPAASLPILDKPCRTYDGVGEHPPAHSAKINAASVL
SQVVSSECNGIFKLPESFSQDSPPDQGILEQAPLDPMPGVPCRDAPDHSLGVFHNPPSIA
CQTLIDPFLGPPCQDLLDSVSSITQEQQLTTQLDPAPWEEDNGQRGNVRNGPLWENLRFG
KGPLEVVRKPISQSQTSEFSFLGSNWDSFQGMVTSLPNGETPRRLLSYGCCSKRSNSKQI
RGSGTYVGGQWVQREGVKSPVCSKHSSGHCTGSAGKTNRTWLSGHLRQVSSTKPISLSCP
SPVPPLYLDDDGLPFPTDVIQHRLRQIEAGYKQEVELLRRQVRELQMRLDIRHCCAPPAE
PPMDYEDDFTCLKESDGSDTEDFGSDHSEDCLSEASWEPVDKKETEVTRWVPDHMASHCY
NCDCEFWLAKRRHHCRNCGNVFCAGCCHLKLPIPDQQLYDPVLVCNSCYEHIQVSRAREL
MSQHLKKPIATASS
NT seq 3645 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgactgcccgcgtctcctgctcaatgctcagctgctttggtgaggaggggccc
cccagcctggagtatatccaagccaaggatctgtttccccccaaggaactagtgaaagaa
gaagagaacctgcaggtacccttcacagtgctgcaaggggagggggtagagttcctaggc
cgggcaactgatgcccttattgccatctccaactaccggttacacatcaagttcaaagac
tcggtcattaacgtgcccttgcgaatgattgacagtgtggagagccgggacatgtttcag
ttgcacattgcctgcaaggattccaaggtggtgaggtgccacttttctacattcaagcag
tgccaagagtggttgtcaaggctgagccgagccacagcaagacctgccaaacctgaggac
ctttttgcctttgcctaccatgcttggtgcctagggttgactgaggaggagcagcacacc
cacctttgccagccaggagagcacatacgatgtcggcaggaggcagagctggtgaggatg
gggtttgacctgcacaacgtctggagagtctcgcacatcaacagcaattacaaattgtgt
cccagttatcctcagaagctattggttcctgtatggatcacagacaaggagctagaaaat
gtggcttctttccgttcatggaagcgaatccctgttgtggtatacaggcacttgcgcaat
ggggctgcgatcgcccgttgcagccagccggagatcagctggtggggttggcgcaatgct
gatgatgagtacttggttacatctattgccaaagcctgtgccctggatcctggagtgagg
gcagctgggggtgtccctttcaatgggaacagtgagggaagtgaaacatgtgatgctgat
ttcgattcctctcttacagcatgctctggagtggagagtactggagcaccccagaagctg
ctcatcttagatgctcgatcatatacagcagcagtggccaaccgggccaagggtggaggc
tgtgaatgtgaagagtactatcccaactgtgaagtggtattcatgggaatggctaatatt
cattccattcggaacagtttccagtaccttcgagccgtctgcagtcagatgccagatcct
agcaactggctgtcagcattggagagcaccaaatggctgcaacacttgtcagtgatgttg
aaggcagcagtgctggtgtccaacacagtggaccgagagggtcggccagttctggttcat
tgttcagatggctgggaccgtactcctcagattgtagccctggcaaagatcctgttggat
ccctactataggactttagagggcttccaagtgctggtggagaccgattggctggacttt
ggtcacaaatttggtgatcgatgtggtcaccaagagaatgcagaggatcagaatgaacag
tgcccagtgtttctccagtggcttgattcagttcaccagctgcttaagcagttcccctgc
ctgtttgaatttaatgaagcctttttggtaaaactggtacagcatacatactcttgtctg
tatggcacattcctggctaacaacccatgggaacgagagatgcgcaacatttataagcgg
acctgttctgtgtggtccctcctccgagcaggcaacaagaatttccacaactttctttat
gttccgggttcggagctggtcctccatcctgtgtgtcacgtgcgggccctgcacctctgg
acagctgtgtaccttccagcatcatctccttgcacacttggagaagatagcatggacctt
taccttcctccagtatctcagagtcaggaattcactggccgatctctggacaggttacct
aaaacaaggtccatggatgatttgttttctgcctgtgacaccagcagtgcactgactcgc
acatctagtgatcccaatctaaataaccactgtcaggaggctagagcaggtctggagccc
tggcacagcaattctgaagggacagatatacccttagcagaacatgggccaggtagccct
cagcagccactggaggaactgggtcatcatctccagcccagtaaccagaaagactgtttg
agcaataatactttgaacaatcacaaaaattatccccccagttacaaattactaaatagc
atggtactacagcaagcgaagagccaccccagcaatcctgaaatcaaagacctggaagaa
accaaggactccgaaccagctgcaagcctacctattctggacaaaccatgtaggacttac
gatggtgttggagaacatccacctgcacacagtgccaagataaatgctgccagtgtgctc
tcccaggttgtttcctctgaatgtaatggaatctttaaacttccggagtccttctctcag
gattcccctcctgatcaaggcattcttgaacaagctcccctagaccccatgccaggcgtg
ccctgtagagatgctccagaccacagtttaggtgtctttcataacccaccaagtattgcc
tgccaaactcttatagacccattcctgggtcccccttgccaagaccttttagactctgtg
tcaagtatcacccaggagcagcagttgactactcagctggatcctgccccctgggaggaa
gataatggtcaaagagggaatgttagaaatgggccattatgggaaaatcttcgatttggc
aaagggccactggaagtggtccgaaagccgatttcccagagtcagacaagtgaattttca
tttttggggtccaactgggacagtttccagggaatggtgacttcactcccaaatggggag
actcctaggcgtctgctttcctatggctgttgcagtaagaggtcaaatagtaagcagata
cgggggtcagggacctatgttggtggccaatgggttcagagagaaggtgtgaaatcacct
gtttgttctaagcattccagtggacactgtactggctcagcaggaaaaaccaacaggaca
tggctatctggtcacctcaggcaggtgtctagtacaaagcctatttcattgagttgccct
tctccggtgcctcctctctacttggatgatgatggcctccctttccccacggatgtgatc
cagcatagattgcggcaaattgaagcgggatacaaacaagaggtagagctgctgcggagg
caggtgcgtgaactccagatgaggctggatatccgtcactgctgtgcccctccagcagag
ccacctatggactatgaggatgactttacatgtttgaaagagtcagatggcagtgataca
gaagattttggttctgatcacagtgaggactgcctttcagaagctagctgggaacctgtt
gataagaaagaaactgaggtgactcgttgggttccagaccatatggcatcccattgctat
aactgtgactgtgaattctggttggccaaacggagacaccactgcagaaattgtgggaat
gtgttctgtgctggatgctgccacctgaagctgcccattcctgaccaacagctctatgat
ccagttcttgtttgtaactcatgttatgaacacatccaagtgtcacgtgccagggaactc
atgagccaacatctgaagaaacccattgctacagcttctagctga

DBGET integrated database retrieval system