KEGG   Sarcophilus harrisii (Tasmanian devil): 100917570Help
Entry
100917570         CDS       T02286                                 

Gene name
DDC
Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00350  Tyrosine metabolism
shr00360  Phenylalanine metabolism
shr00380  Tryptophan metabolism
shr01100  Metabolic pathways
shr04726  Serotonergic synapse
shr04728  Dopaminergic synapse
shr05030  Cocaine addiction
shr05031  Amphetamine addiction
shr05034  Alcoholism
Module
shr_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
shr_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100917570 (DDC)
   00360 Phenylalanine metabolism
    100917570 (DDC)
   00380 Tryptophan metabolism
    100917570 (DDC)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    100917570 (DDC)
   04726 Serotonergic synapse
    100917570 (DDC)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    100917570 (DDC)
   05031 Amphetamine addiction
    100917570 (DDC)
   05034 Alcoholism
    100917570 (DDC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    100917570 (DDC)
Enzymes [BR:shr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     100917570 (DDC)
    4.1.1.105  L-tryptophan decarboxylase
     100917570 (DDC)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100917570 (DDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 100917570
NCBI-ProteinID: XP_003762585
Ensembl: ENSSHAG00000016359
UniProt: G3WV06
Position
2
AA seq 485 aa AA seqDB search
MNTAEFRKRGKEMVDYVADYIEGIHKRQVYPDVEPGYLRPLIPDSAPQEPETFEDIIKDV
EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLSGAIGCIGFSWVASPACTELETVMLD
WLGKMINLPEAFLAGKDGEGGGVIQGSASEATLVTLLAARTKVIRQLQAKSPGLTEAAIM
DKLVAYASDQSHSSVERAGLIGGVKLKLIPSDDKFSLRGSALQKMLDEDKATGLIPFFMV
ATLGTTSCCSFDNLLELGPICNKENIWMHIDAAYAGSAFICPEFRPLLNGVEFADSYNFN
PHKWLLVNFDCSAMWVKKRADLIGAFKLDPVYLQHHNQESGLVTDYRHWQIPLGRRFRSL
KMWFVFRMYGVKKLQEYIRKHVKLSHEFESLVQKDPRFEVCAEVVLGLVCFRIKGSNELN
EALLEKINKTKKIHLVPCHLRDKYVLRFAICSRTVESVHIQEAWQHITELATELLKKEKE
KKTSQ
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaacacagctgaatttcgaaagagagggaaagaaatggtggattatgtggcagactac
attgagggaattcataaacgtcaggtttatccagatgtggagccaggctatctgagacca
ctgatacctgactctgccccccaggaaccagagacatttgaagacatcattaaggatgtt
gagaagataattatgccaggggtaactcactggcatagtccctacttctttgcttatttc
cccacagccagttcatacccggcaatgctggctgacatgctatcaggggccataggctgc
attggcttttcctgggttgcaagtcctgcttgcacagagttagagacagtgatgttggat
tggctggggaagatgatcaatctgccagaagcatttttagctggaaaagatggagaaggg
ggaggagtgattcagggaagtgccagtgaagctaccttggttaccttacttgctgctaga
accaaagtgattcggcaactccaggccaagtctccaggactgaccgaagcagccatcatg
gacaagctggtggcctatgcatccgatcaatctcactcatcagtggaaagggctggatta
attggtggcgtgaagttaaaattgatcccttcagatgataaattttctctacgaggatca
gccctacagaagatgctggatgaagacaaagccaccggcctcatcccattctttatggtt
gctacacttggaaccacttcttgctgttcatttgacaatctattagaactgggtcctatt
tgtaataaggagaatatctggatgcatatcgatgcagcatatgcaggaagtgccttcatc
tgccctgaatttcggcctcttctgaatggagttgagtttgcagattcatataactttaat
cctcataaatggcttttggtgaattttgactgctctgccatgtgggtgaaaaagagagca
gatttgataggtgcctttaaactggatcctgtttacctacagcatcataaccaagaatct
ggtcttgtcactgactaccggcactggcagataccactgggccggaggtttcgctctctg
aaaatgtggtttgtatttaggatgtatggtgtaaagaaactacaagaatacattcgtaag
catgtgaaactatctcatgaatttgaatctttggtgcaaaaagatccccgatttgaggtg
tgtgctgaagtcgtgttggggctggtgtgtttccgaattaagggttccaatgaactgaac
gaagcacttcttgaaaaaataaacaagaccaaaaaaatccacttggtcccatgtcacctc
agagacaagtatgttctgcgctttgctatctgctctcgcacagtagagtctgtccatatc
caggaggcctggcagcacattacagagctggcgactgagctgctgaaaaaggaaaaagag
aagaaaacgagccagtaa

DBGET integrated database retrieval system