KEGG   Sarcophilus harrisii (Tasmanian devil): 100917725
Entry
100917725         CDS       T02286                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
KEGG Orthology (KO) [BR:shr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:shr01009]
    100917725 (AKAP5)
Protein phosphatases and associated proteins [BR:shr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     100917725 (AKAP5)
SSDB
Motif
Pfam: WSK Calici_coat
Other DBs
NCBI-GeneID: 100917725
NCBI-ProteinID: XP_003756400
Ensembl: ENSSHAG00000009730
Position
2
AA seq 449 aa
MQKMETTVAEIQVESKDEKESIDVSPQAEEQAEKASMICFKRRKKSSKALKSKNCSEKAP
HHTGPSSAKDHTEMEASDQFQSPQGTWAAIRRFVTRQKRSKSSKKQVPLDAKAQPKENTD
DTKPTKKKARSRIKIPCIKLSRSKKKCSHSQIIEESECNMKVKEVTGSSGTEIQIPQEAP
AVKEKLTADISGDNSQGDSARVPQVSNINSSGENLASIELGADTESCAIHTAALILEKDM
EKTEEKQVVSLHQGSLPETSEVGHQLPPENTEVSSAVVPTEPPTEPPATPETQVMEETIK
DVMEQEPKEKEHENGGMASEKNKSKDTTVCFSAFKENTVSPKTPQLEESKRMEPIAIIVT
DTEVSEFDVKKSKNVPKKFLISVENQQSEPFSNAVSSKGVNDFEGRTSEQYEKLLIETAS
SLVKNAIQLSIEQLVNEMDSDDNKRNNLI
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgcaaaaaatggagacaacagtggcagaaattcaagtagaaagcaaggatgagaaagaa
tctatagacgtaagtcctcaggctgaggagcaggctgaaaaagcatccatgatttgtttt
aaaagaagaaagaaatcatccaaagctttgaagtctaagaattgttctgaaaaagcaccg
catcacacaggtccaagcagtgctaaggatcacacggaaatggaagcttcagatcagttt
cagtcaccacaggggacttgggcagcgattagacgttttgtcactcgacagaaaaggtca
aaatcttcaaagaaacaagtccccttagatgctaaagcacaacctaaggaaaacacggat
gacaccaaacccactaagaaaaaggctcgatccaggattaaaattccttgcataaaactc
tcgagaagcaagaaaaaatgcagccattcccaaatcatcgaagaatctgaatgcaatatg
aaagtaaaggaagttacaggcagttcaggtacagagatccagattcctcaggaagctcca
gctgtaaaggaaaaattaactgcagacataagtggtgataactcccagggagatagtgca
agggtgccacaggtgagtaacatcaactcttctggggagaatctggcttccatagaactt
ggggctgatacagagtcttgtgctattcatacagcagcattaatcctagaaaaagatatg
gaaaagacagaggagaaacaggttgttagcctccatcaaggaagcctccctgagacttca
gaagtgggacatcagctccccccggagaatacagaggtcagtagtgctgtggtacccact
gaaccccccacagagccacctgccaccccagaaacacaggtcatggaagaaaccattaag
gatgtcatggaacaggaaccaaaagagaaagaacatgaaaatggagggatggcttcagaa
aaaaacaagtcaaaggataccacagtgtgcttcagtgctttcaaagaaaatacagtaagt
ccaaaaacaccccagttagaagaaagcaaaaggatggaaccaattgctattattgtcaca
gacactgaagtcagtgaatttgatgtaaagaaatccaaaaatgtccctaagaaattctta
atttcggttgaaaatcagcaaagtgagccattttctaatgctgtatcatccaaaggggtt
aatgattttgagggcagaacttctgagcagtatgagaagcttttaatagaaactgcttcc
tcgcttgtcaagaacgccattcagttgtctatagaacaactggtgaatgaaatggattct
gatgacaacaaaagaaacaatcttatataa

DBGET integrated database retrieval system