KEGG   Sarcophilus harrisii (Tasmanian devil): 100917854Help
Entry
100917854         CDS       T02286                                 

Definition
(RefSeq) L-amino-acid oxidase-like
  KO
K03334  L-amino-acid oxidase [EC:1.4.3.2]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00250  Alanine, aspartate and glutamate metabolism
shr00270  Cysteine and methionine metabolism
shr00280  Valine, leucine and isoleucine degradation
shr00350  Tyrosine metabolism
shr00360  Phenylalanine metabolism
shr00380  Tryptophan metabolism
shr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
shr01100  Metabolic pathways
Module
shr_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100917854
   00270 Cysteine and methionine metabolism
    100917854
   00280 Valine, leucine and isoleucine degradation
    100917854
   00350 Tyrosine metabolism
    100917854
   00360 Phenylalanine metabolism
    100917854
   00380 Tryptophan metabolism
    100917854
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100917854
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.2  L-amino-acid oxidase
     100917854
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_2 Pyr_redox_2 HI0933_like Pyr_redox DAO FAD_oxidored Thi4 AlaDh_PNT_C FAD_binding_3 NAD_binding_7 Pyr_redox_3 Shikimate_DH GIDA DUF1188 FMO-like TrkA_N Trp_halogenase MCRA
Motif
Other DBs
NCBI-GeneID: 100917854
NCBI-ProteinID: XP_003766701
Ensembl: ENSSHAG00000001195
Position
3
AA seq 530 aa AA seqDB search
MNILSTGILTFAFILAISSCHGYFDILQCFQDPEYEAILKTAQEGLGTSASKKHILVVGA
GMSGLVAAKTLQDAGHKVTVLEANHKIGGRVTTFRSPNNDWYIDLGPMRLPSNHRLVRFY
VEKLGLKMNTFIPSNNNTWYYIKGQRHRTSDVLANPDILGYSVKPEESGKMPSTLFKEAI
AKVMEKLRHHNCSHLFSTYDSFSTKAYLLKEGQLSRGAVQMIGDIMNEDAGYYKSLLQSL
RNEITYFQIDSFDEITGGFDQLPNALYHTLKPGTVSLRTTVEKVEMVGPQVKITYQRERP
SSGQSIITGDFAIISSSAKATRLIQFEPPLSLAKQKALRSVHYTSATKVALAFKERFWER
DGIKGGSSITDLPTRFIYYPSHNFSGNISVLLASYTVGDDSTFFLGMKYNKLVDLVLGDL
ATIHQRSKKELQDLCEASVVKHWYLDPFTLGAYPEFTPYQFVDYSKILFEPEGNIHFAGE
HTSLLHGWIDTAIKSGIQVARRIQAAIDAAADTDTDVSLDEGSTFFQGNQ
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaacattttgtccacaggtatcctgacctttgccttcatcctggccatttctagttgc
catggctattttgacattcttcagtgcttccaggaccctgaatatgaagctattctgaaa
actgcccaggagggacttggtacctctgcctctaagaagcatatccttgtggtaggagct
gggatgtctggattggtggcagctaagacccttcaggatgctggacacaaggtgacagtc
ttagaagccaatcacaaaattgggggaagagtgacaacattccggagcccaaacaatgac
tggtacatcgacctgggtcctatgagattgccaagcaatcacaggctggtccgattctat
gtggagaagcttggtctaaaaatgaacacctttatcccgtccaataacaacacctggtat
tatatcaaaggccaacgacatagaacttcagatgtgttggccaatcccgacatcctggga
tactctgtgaaacccgaggagtcaggcaagatgcccagtacactcttcaaagaagcaata
gctaaggtgatggaaaaactgagacatcataactgtagtcacttgttctctacatatgac
tccttctctaccaaggcctaccttctaaaggaggggcagttgagcagaggagctgttcag
atgattggagatatcatgaatgaagatgcaggctactataaatctctcttgcagtcccta
agaaatgaaattacctacttccaaatagatagctttgatgaaatcactggtggctttgat
cagctccccaatgccctctaccacaccttgaaacctggcactgtctcactgaggacaaca
gtggagaaggtagaaatggttggacctcaggtcaagattacctaccagagggaaagaccc
tcctcaggccagtccatcatcacaggtgactttgccattatctcttcatcagccaaggcc
acacgcctcatccagtttgagccaccactctccttggccaagcaaaaggccctccgttct
gttcattacaccagtgccaccaaggtggccctggccttcaaggaacgcttttgggaacga
gatggcatcaaaggtggatcatccatcacagacctgcccactagattcatctactacccc
agccataatttctctggcaacataagtgtccttttggcctcctatactgtgggtgatgac
tctacctttttcctgggcatgaaatataataagttggtggatctggtgctgggtgatttg
gcaactatccatcagagatctaaaaaggagctccaggatttgtgtgaggcatctgtggtg
aaacactggtacctagacccattcaccttgggtgcatatccagaatttaccccttaccag
tttgttgactattcaaaaatactctttgagcctgagggaaacattcactttgcaggtgag
cacactagtctgctccatggctggatagacacagcaataaaatctgggatccaggtagct
cggaggatacaggcagccattgatgctgctgctgacactgatactgatgtgtctttggat
gagggatcaactttctttcaaggaaatcaatga

DBGET integrated database retrieval system