KEGG   Sarcophilus harrisii (Tasmanian devil): 100918168Help
Entry
100918168         CDS       T02286                                 

Gene name
GCK
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00010  Glycolysis / Gluconeogenesis
shr00052  Galactose metabolism
shr00500  Starch and sucrose metabolism
shr00520  Amino sugar and nucleotide sugar metabolism
shr00524  Neomycin, kanamycin and gentamicin biosynthesis
shr01100  Metabolic pathways
shr01200  Carbon metabolism
shr04910  Insulin signaling pathway
shr04911  Insulin secretion
shr04917  Prolactin signaling pathway
shr04922  Glucagon signaling pathway
shr04930  Type II diabetes mellitus
shr04950  Maturity onset diabetes of the young
shr05230  Central carbon metabolism in cancer
Module
shr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
shr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100918168 (GCK)
   00052 Galactose metabolism
    100918168 (GCK)
   00500 Starch and sucrose metabolism
    100918168 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    100918168 (GCK)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100918168 (GCK)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    100918168 (GCK)
   04910 Insulin signaling pathway
    100918168 (GCK)
   04922 Glucagon signaling pathway
    100918168 (GCK)
   04917 Prolactin signaling pathway
    100918168 (GCK)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100918168 (GCK)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100918168 (GCK)
   04950 Maturity onset diabetes of the young
    100918168 (GCK)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     100918168 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 100918168
NCBI-ProteinID: XP_023350318
Ensembl: ENSSHAG00000014686
Position
1
AA seq 460 aa AA seqDB search
MKRNQSTLALVEQILSEFRLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLPTYVRST
PEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEMLFDY
ISECISDFLDKHHMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNIVGLL
RDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRQCEVGMIVGTGCNACYMEEMENVELVE
GDEGRMCVNTEWGAFGDAGELDEFLLEYDRVVDETSLNPGQQLYEKIIGGKYMGEIVRLV
LLKLVDENLLFNGEASEQLRTRGAFETRFVSQVESDSGDRKQIYNILSTLGLLPSTTDCD
IVRMVCESVSTRAAQMCSAGLAGVINRMRESRSEEVMRITVGVDGSVYKLHPSFKHRFHA
TVRQLAPCCDITFIQSEEGSGRGAALVSAVACKKACMLSQ
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggaaccaatcaaccttggctctggtggaacaaatcttgtctgagttcaggcta
caggaagaagacctaaagaaagtgatgaggaggatgcagaaggagatggaccggggcctg
cggctggagacccatgaagaagccagtgtgaagatgctccccacttacgtgcgctccacc
cccgaggggtcagaagtgggagatttcctctccttggatctgggcggcacaaatttccgg
gtaatgttggtaaaagtgggagaaggagaggagggtcagtggagtgtgaagacaaaacat
cagatgtactccatccctgaggatgccatgacaggaacggcagaaatgctatttgactac
atctctgaatgcatttctgatttcctggacaaacaccatatgaaacataaaaagttgcct
ctgggcttcacattctccttccccgtgcggcatgaagacattgacaagggaatccttctc
aactggacaaaaggcttcaaagcatcaggtgccgaagggaacaacatagtcgggctcttg
agagatgctatcaagcggcgtggggactttgagatggatgttgttgccatggtcaacgac
acagtggcgacaatgatttcctgctactatgaagaccgccagtgtgaggtcggcatgatt
gttggcacggggtgtaacgcctgctacatggaggagatggagaacgtggaactggtggaa
ggggacgaaggccgcatgtgtgtgaacaccgagtggggagcctttggggatgctggagaa
cttgacgagttcctgctggagtatgaccgggtggtggatgagacctccctgaaccccggt
cagcagctttatgagaagatcatcgggggcaagtacatgggggagatcgtgaggctggtt
ctactgaaactggtagatgagaatttgctcttcaacggggaagcatctgaacagctgagg
acccggggggccttcgagacccgtttcgtctcccaagtggagagtgattctggggaccga
aagcagatctacaacatcctgagtactctgggactgcttccctccaccacagactgtgat
attgtgcgcatggtctgtgagagtgtctccacccgggcagcccagatgtgctccgcaggg
ttagcaggtgtcatcaaccgcatgcgggaaagtcgcagcgaggaggtcatgaggatcacc
gtcggtgtggacggctctgtctacaaactgcaccccagcttcaaacaccgattccatgct
actgtgcggcagctggccccctgttgtgacatcacctttatccagtcagaggagggcagc
ggccggggggctgcccttgtctctgccgtggcctgcaaaaaggcctgcatgcttagccag
tga

DBGET integrated database retrieval system