KEGG   Sarcophilus harrisii (Tasmanian devil): 100919591Help
Entry
100919591         CDS       T02286                                 

Gene name
PLCD4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00562  Inositol phosphate metabolism
shr01100  Metabolic pathways
shr04020  Calcium signaling pathway
shr04070  Phosphatidylinositol signaling system
shr04919  Thyroid hormone signaling pathway
shr04933  AGE-RAGE signaling pathway in diabetic complications
Module
shr_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100919591 (PLCD4)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100919591 (PLCD4)
   04070 Phosphatidylinositol signaling system
    100919591 (PLCD4)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100919591 (PLCD4)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100919591 (PLCD4)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100919591 (PLCD4)
Membrane trafficking [BR:shr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100919591 (PLCD4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100919591 (PLCD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 PH EF-hand_6 EF-hand_7 EF-hand_1 EF-hand_5 PH_12 GDPD Wap1
Motif
Other DBs
NCBI-GeneID: 100919591
NCBI-ProteinID: XP_003765980
Ensembl: ENSSHAG00000015736
UniProt: G3WSY4
Position
3
AA seq 769 aa AA seqDB search
MASPLHSIRLPLDDDLLLMQNGSILRKVKSRSWKKQRYFRLQDDGMTVWYARQAGGRAKP
SFSISDVETVREGHESELLRSLADEIPLEHGFTVVFHGRRPNLDLVASSIEEAQSWVQGL
RRLLEIITSMDQQEKMDQWLSDWFQQGDKDQDGRMSFREVQRLLRLMNVDMDPEHALQLF
QAADKSESGMLEGEEFVEFYRALTQRSEILELFEILSGDGQKLTLLEFADFLREEQREGE
HASDLALELIARYEPSDSAKLRHVLTIDGFLAYLCSPDGDIFSPACRPVYQDMSYPLNHY
FIHSSHNTYLLGDQFRGQSSVEGYIRALKRGCRCVEVDVWDGPSGEPIVYHGHTLTSRIP
FQDVVATIAQYAFQTSDFPVIVSLENHCSWEQQEVIAQHLTEILGDRLLNTTLDGLLPTQ
LPSPEELRGKILLKGKKMGTLEEELGEAPGEPEELEEPEEEEEPEPELEPDVLDFDETAR
NEDKRKKKVGLEKSKTTLCPALSALVVYMKSVPFRSFAHSKAHYRLYETSSFSETKARRL
VKEAGNEFVQHNAWQLSRVYPSGLRTDSSNYSPQELWNAGCQMVALNIQTAGLEMDLCDG
LFSQNGSCGYVLKPAFLCDPQSSFHPERPPSPTLTLLIQVISGQQLPKVANSKEGSIVDP
LVRVEIYGVPGDTARQETSYVENNGFNPYWGQTLQFRVRVPELALLRFVVEDYDRASRND
FVGQYTLPWTCVQQGYRHIHLLSKDGTSLHPASIFVHIQIREELDEDGD
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcccttgcacagcatccggctgcctctggatgatgatctgctgttgatgcag
aatgggtctatactacgcaaggtcaaatcccgaagctggaagaaacagagatactttaga
ctgcaggatgatgggatgactgtttggtatgcccggcaggctggtggaagagccaaaccc
agcttctccatttcagatgtggagacagtgcgagaaggccatgaatcagaactgttgcgg
agccttgctgatgaaatccctttagagcatggctttacagttgttttccacgggcgccgt
cccaacctggacctggtggccagcagcattgaagaggcacagagctgggtgcaagggctt
cggcgcctgctggagattatcaccagcatggaccagcaggagaagatggaccaatggctg
agtgattggtttcagcagggagacaaagaccaggatgggagaatgagtttccgggaagta
caacgattgctccggttgatgaatgtagatatggaccctgagcatgctctgcagctcttc
caggccgcagacaaatcagagtcagggatgttggaaggagaagaatttgtagagttctat
cgggccctgacccagcgctcagagatactggagctgtttgaaatcctctctggagatggc
cagaagctgacgctgctggagtttgcagatttccttcgggaagagcagagagagggagag
catgcttctgaccttgccttggaattgattgctcgctatgagccatcagacagtgccaaa
ctgcggcacgtcctgaccatcgatggttttctcgcatacctctgttccccggatggagat
atcttctctccagcttgccgccctgtctaccaggacatgagctacccgctgaatcattac
ttcattcactcctcacacaacacttacctgctgggggaccagtttcgaggacagagcagt
gtggaaggctacatacgggctctcaagcgtggatgtcgctgtgtggaagtggacgtatgg
gatggacccagtggggaaccgattgtttaccacggacacacactgacttctcggatcccc
ttccaagatgtcgtggccaccattgcccagtacgccttccagacatcagacttcccagtc
atagtgtcccttgagaatcactgcagctgggaacaacaagaggtcattgctcagcacctg
acagagatcctgggagaccgactgcttaatactaccttggatgggctcctgcccacccaa
ctgccatcaccggaggaacttcgagggaagattctcctcaaggggaagaagatggggaca
ttggaagaggagcttggggaggctccgggggaacctgaggagctggaagagcctgaagaa
gaggaagagcctgagccagaactggagcccgatgtgttggattttgatgagacagcccga
aatgaggacaagaggaaaaagaaagtgggacttgagaaatccaagaccaccctgtgtcca
gccctgtcggccctagttgtctatatgaagagcgtcccatttcgaagttttgcacactcg
aaggctcactaccgcctctacgagacatcgtccttctctgagacaaaggcccggcgcctg
gtcaaggaggctgggaacgaatttgtgcaacacaacgcgtggcagctgagccgagtgtat
cccagtggtctgaggacagattcctccaattacagccctcaggagctttggaacgcaggc
tgccagatggtggccctgaacattcagactgcagggctggagatggatctttgtgatggg
cttttcagtcagaatggcagctgtggctacgtgctgaagccagctttcctgtgtgacccc
caaagttcctttcaccccgagagaccccccagtcccactctgactcttctcattcaggtg
atcagtggtcagcagctacccaaagtggccaacagcaaagagggctcaattgtggatccc
ctggtgagggtggaaatctacggcgtgcccggagacacggcgcggcaagagaccagctat
gtggagaacaatggttttaatccatactgggggcagacactgcagttccgagtgcgagtg
ccggagctagccctgctgcggtttgtggtggaggactatgacagggcctcgagaaatgac
tttgtgggtcagtacacactgccttggacctgtgtccaacaaggttaccgtcacatacat
cttctctctaaggatgggacgagcctccaccccgcctccatctttgtgcacatccagatc
cgggaagagctggatgaggacggagactga

DBGET integrated database retrieval system