KEGG   Sarcophilus harrisii (Tasmanian devil): 100919688Help
Entry
100919688         CDS       T02286                                 

Gene name
GBA
Definition
(RefSeq) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00511  Other glycan degradation
shr00600  Sphingolipid metabolism
shr01100  Metabolic pathways
shr04142  Lysosome
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100919688 (GBA)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100919688 (GBA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100919688 (GBA)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     100919688 (GBA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 100919688
NCBI-ProteinID: XP_012403641
Ensembl: ENSSHAG00000007951
UniProt: G3W179
Position
4
AA seq 536 aa AA seqDB search
MGPSKRRREEHPRDLGKVNNVAATGLGLLLLQMVSCTASSRPCVPQSFGYSSVVCVCNAT
YCDTLDPVTLPDSGTFSRYESTRSGRRFELSVGSIQSNWTGKGLLLSLRPDQQFQKIKGF
GGAMTDAAALNILALTPPAQDLLLKSYFSPEGIEYNIIRVPMASCDFSIRVYTYADHPDD
FQLTNFTLPEEDTKLKIPLIHRAQALAQRPTSLFASPWTSPTWLKTNGAVNGKGSLKGKP
GDKYHKTWANYFIKFLDAYAEHKLKFWAVTAENEPSAGMISGYPFQCLGFTPELQRDFVA
LDLGPALAQSDHHDTKLLILDDQRLLLPHWAQVVLKDPKAAQYVSGIAVHWYLDFLAPAK
ATLGETHRLFPDMMLFASEACVGSKFWEQSVRLGSWSRGTQYSHSIITNLIYHVVGWTDW
NLALNPEGGPNWVRNFVDSPIIVDIGKDRFYKQPMFYHLGHFSKFIPEGSQRIGLDASQK
THLETVALLRPDGAAVLVVLNSSSQDEPLTIADPAVGFIQTLAPAYSIQTYLWQRQ
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgggaccctcgaagcgccggagagaggaacatcccagggatttggggaaagtcaacaac
gtcgctgcaactggcttgggattgcttttgcttcagatggtttcctgcacagcgagttcc
cgtccctgtgtcccgcaaagctttggctatagctctgtggtctgcgtctgcaatgctacc
tactgtgacacgctggatcctgtaacacttcctgactctggtacctttagccgatatgag
agcacccgaagtggacggaggttcgaattgagtgttgggtccatccagagcaactggaca
ggcaaagggttgcttctatcccttcgaccagatcaacagtttcagaagataaaaggcttt
ggaggagcaatgactgatgctgctgccctcaacattctagccctgacacctcctgcccag
gatttactccttaagtcctacttttctccagaaggcattgaatataacatcatccgagtg
cccatggccagctgtgacttctctattcgtgtctatacttatgctgaccaccctgacgac
ttccagttgaccaatttcacccttcccgaggaggacaccaagctcaagattccccttatt
caccgggctcaagccctggcccaacgccctacctcactctttgccagcccgtggacatca
cctacctggcttaagaccaatggggcagtgaatgggaaaggatcactcaagggaaaacca
ggagacaagtaccataagacctgggccaactactttatcaagttcctggatgcttatgca
gaacataagttgaagttttgggcagtgacagcagagaatgaaccatcagcgggaatgata
agtgggtatcccttccagtgcctgggcttcactccagaacttcagcgcgattttgttgcc
cttgacctaggccctgcccttgctcaaagtgatcaccatgacaccaaactactaatactg
gatgatcaacgccttctactgccccactgggcacaggtggtgctgaaggaccctaaagcc
gctcagtatgtctctgggatagctgtgcactggtacctggacttcctggccccagccaaa
gccacactgggggaaacgcaccgcttgttccccgatatgatgctctttgcttctgaggcc
tgtgtaggctccaagttttgggaacagagcgttcggctaggttcctggagccgagggaca
cagtacagccacagcattatcactaatctgatctaccatgtagtaggatggacagactgg
aaccttgccctgaatcctgaaggggggcccaactgggtgcgcaacttcgtggatagtccc
atcattgtggatataggcaaggacaggttttataagcagcctatgttttaccatcttgga
cacttcagcaaattcattcctgagggctcccagaggataggactggatgccagccagaaa
acccacctggagacagtggccttactgcgccccgacggtgctgctgtgttagtggtgctc
aatagctcttcccaggacgaacctcttaccattgctgatcctgctgtgggcttcatacag
accttggcacctgcctactccattcagacatacctctggcagcgccagtaa

DBGET integrated database retrieval system