KEGG   Sarcophilus harrisii (Tasmanian devil): 100919776Help
Entry
100919776         CDS       T02286                                 

Gene name
FASLG
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01524  Platinum drug resistance
shr04010  MAPK signaling pathway
shr04014  Ras signaling pathway
shr04060  Cytokine-cytokine receptor interaction
shr04068  FoxO signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04210  Apoptosis
shr04217  Necroptosis
shr04650  Natural killer cell mediated cytotoxicity
shr04722  Neurotrophin signaling pathway
shr04932  Non-alcoholic fatty liver disease (NAFLD)
shr04940  Type I diabetes mellitus
shr05142  Chagas disease (American trypanosomiasis)
shr05143  African trypanosomiasis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05168  Herpes simplex virus 1 infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05320  Autoimmune thyroid disease
shr05330  Allograft rejection
shr05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100919776 (FASLG)
   04010 MAPK signaling pathway
    100919776 (FASLG)
   04068 FoxO signaling pathway
    100919776 (FASLG)
   04151 PI3K-Akt signaling pathway
    100919776 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100919776 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100919776 (FASLG)
   04217 Necroptosis
    100919776 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100919776 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100919776 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100919776 (FASLG)
   05205 Proteoglycans in cancer
    100919776 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100919776 (FASLG)
   05330 Allograft rejection
    100919776 (FASLG)
   05332 Graft-versus-host disease
    100919776 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100919776 (FASLG)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100919776 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100919776 (FASLG)
   05162 Measles
    100919776 (FASLG)
   05164 Influenza A
    100919776 (FASLG)
   05161 Hepatitis B
    100919776 (FASLG)
   05160 Hepatitis C
    100919776 (FASLG)
   05168 Herpes simplex virus 1 infection
    100919776 (FASLG)
   05163 Human cytomegalovirus infection
    100919776 (FASLG)
   05165 Human papillomavirus infection
    100919776 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    100919776 (FASLG)
   05143 African trypanosomiasis
    100919776 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100919776 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    100919776 (FASLG)
   04052 Cytokines and growth factors [BR:shr04052]
    100919776 (FASLG)
   04090 CD molecules [BR:shr04090]
    100919776 (FASLG)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100919776 (FASLG)
Cytokines and growth factors [BR:shr04052]
 Cytokines
  Tumor necrosis fators
   100919776 (FASLG)
CD molecules [BR:shr04090]
 Proteins
  100919776 (FASLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF LapA_dom DUF4574
Motif
Other DBs
NCBI-GeneID: 100919776
NCBI-ProteinID: XP_003767469
Ensembl: ENSSHAG00000018421
UniProt: G3X251
Position
4
AA seq 270 aa AA seqDB search
MQQNLNYLYPQIYWVDSRASPPCVPPVTTIPCPSPGLRRPPPPPPPSPPLPHSPPFLPYS
SVKKRTNNTSLCLLLVFFMVLVALAGLGMGMFQLFHLQEEIAKLRESINDGEVVSSPEQQ
IGHPNTLEMKALKKAAHLTGKPKSQGMTLEWEDTYGFTLISGVKYKNRSLVINDTGLYFV
YSKVYFRGQKCDNQPLKHILYKRNPTYPKDLVLMEEMKMNYCTSKQMWAQSSYLGAVFNL
TSADSLYVNVSSFSLVNFEESKTFFGLYKL
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagaacctgaattatctctaccctcaaatctactgggtggacagcagggctagc
cctccctgtgttcctccagtgacaactattccctgtccatcccctggtctgaggaggcca
cctccgcctcctcctccatcaccaccactaccccattctcccccttttctaccctactca
tctgtaaagaagaggaccaacaacacaagtctctgtcttcttctggtcttttttatggtt
ctagtggccctggctggactgggaatgggaatgtttcaacttttccacctgcaggaggag
atagctaaactcagagagtctatcaacgatggggaggtagtttcatctcctgagcaacaa
ataggtcaccccaacacattggaaatgaaggcattaaagaaagcagcccatctaacaggc
aagcctaaatcacaaggcatgaccctcgaatgggaggacacctatggatttaccctgatt
tctggagtcaaatataagaaccgcagtctggtgatcaatgatactggcctttactttgtc
tactccaaggtatacttcaggggccagaagtgtgacaaccagccccttaaacatatactt
tataaaaggaatcccacctatcccaaagacttggtactgatggaagaaatgaagatgaac
tattgtacttccaagcagatgtgggcccaaagcagctacctgggggccgtgttcaatctc
actagtgccgacagtttgtatgtcaacgtctcttcattttcattggtcaattttgaggaa
tccaagacattttttggcttatataaactctag

DBGET integrated database retrieval system