KEGG   Sarcophilus harrisii (Tasmanian devil): 100920243
Entry
100920243         CDS       T02286                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00230  Purine metabolism
shr01100  Metabolic pathways
shr01522  Endocrine resistance
shr04015  Rap1 signaling pathway
shr04020  Calcium signaling pathway
shr04022  cGMP-PKG signaling pathway
shr04024  cAMP signaling pathway
shr04062  Chemokine signaling pathway
shr04072  Phospholipase D signaling pathway
shr04114  Oocyte meiosis
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr04261  Adrenergic signaling in cardiomyocytes
shr04270  Vascular smooth muscle contraction
shr04371  Apelin signaling pathway
shr04540  Gap junction
shr04611  Platelet activation
shr04713  Circadian entrainment
shr04714  Thermogenesis
shr04723  Retrograde endocannabinoid signaling
shr04724  Glutamatergic synapse
shr04725  Cholinergic synapse
shr04727  GABAergic synapse
shr04742  Taste transduction
shr04750  Inflammatory mediator regulation of TRP channels
shr04911  Insulin secretion
shr04912  GnRH signaling pathway
shr04913  Ovarian steroidogenesis
shr04914  Progesterone-mediated oocyte maturation
shr04915  Estrogen signaling pathway
shr04916  Melanogenesis
shr04918  Thyroid hormone synthesis
shr04921  Oxytocin signaling pathway
shr04923  Regulation of lipolysis in adipocytes
shr04925  Aldosterone synthesis and secretion
shr04926  Relaxin signaling pathway
shr04927  Cortisol synthesis and secretion
shr04928  Parathyroid hormone synthesis, secretion and action
shr04934  Cushing syndrome
shr04935  Growth hormone synthesis, secretion and action
shr04970  Salivary secretion
shr04971  Gastric acid secretion
shr04972  Pancreatic secretion
shr04976  Bile secretion
shr05032  Morphine addiction
shr05163  Human cytomegalovirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05200  Pathways in cancer
shr05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100920243 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100920243 (ADCY4)
   04371 Apelin signaling pathway
    100920243 (ADCY4)
   04020 Calcium signaling pathway
    100920243 (ADCY4)
   04072 Phospholipase D signaling pathway
    100920243 (ADCY4)
   04024 cAMP signaling pathway
    100920243 (ADCY4)
   04022 cGMP-PKG signaling pathway
    100920243 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100920243 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100920243 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100920243 (ADCY4)
   04062 Chemokine signaling pathway
    100920243 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    100920243 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    100920243 (ADCY4)
   04912 GnRH signaling pathway
    100920243 (ADCY4)
   04913 Ovarian steroidogenesis
    100920243 (ADCY4)
   04915 Estrogen signaling pathway
    100920243 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    100920243 (ADCY4)
   04921 Oxytocin signaling pathway
    100920243 (ADCY4)
   04926 Relaxin signaling pathway
    100920243 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    100920243 (ADCY4)
   04918 Thyroid hormone synthesis
    100920243 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    100920243 (ADCY4)
   04916 Melanogenesis
    100920243 (ADCY4)
   04925 Aldosterone synthesis and secretion
    100920243 (ADCY4)
   04927 Cortisol synthesis and secretion
    100920243 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100920243 (ADCY4)
   04270 Vascular smooth muscle contraction
    100920243 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    100920243 (ADCY4)
   04971 Gastric acid secretion
    100920243 (ADCY4)
   04972 Pancreatic secretion
    100920243 (ADCY4)
   04976 Bile secretion
    100920243 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100920243 (ADCY4)
   04727 GABAergic synapse
    100920243 (ADCY4)
   04725 Cholinergic synapse
    100920243 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    100920243 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    100920243 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    100920243 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    100920243 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    100920243 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100920243 (ADCY4)
   04714 Thermogenesis
    100920243 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100920243 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    100920243 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100920243 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100920243 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100920243 (ADCY4)
   05163 Human cytomegalovirus infection
    100920243 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100920243 (ADCY4)
Enzymes [BR:shr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100920243 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52 DUF2254
Other DBs
NCBI-GeneID: 100920243
NCBI-ProteinID: XP_003755950
Ensembl: ENSSHAG00000006340
UniProt: G3VVT7
Position
2
AA seq 1073 aa
MPRLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLVIVLSTLLALLTVTWASGRALGSDPA
FLAGVLCALGGFALLLCLASREQRLQRWTRPVSGLVWAALLALGHSFLFTGGVVSAWDQV
SFFLFIIFTVYTMLPLGMRDAAVAGFASSLSHLLVLGLYLGPQPVSRPPLLPQLAANAVL
FLCGNAAGAYHKALMERALRATFREALSSLHSRRRLDSEKRHQEHLLLSILPAYLAREMK
AEIMARLQAGQGPRPEGTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHALNCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLGG
AYAVEDAAPGHRDPYLRELGEPTYLVIDPRAEEEEEEEVTAGGPLSPPEGPKMRPSLLMT
RYLESWGAAKPFAHLSHPDSPVPVSPPLPENALASLGPQRSLDRTRTPRGLEDELDTGDE
KFFQVIEQLNSQKQWKRSKDFSPFTLYFREKEMEKEYRLSALPAFKYYAACTFLVFLSNF
TIQMLVANRPPALTVTYGIIFILFCLLLFICFSEHMTRCVLKGPKFLHWLPALSGTVATR
PGLRVALGTTTILIVLTMAIVNLFFQPVSDCSFPAHNSSAAALNSSWEISGSLPLISIPY
SMHCCVLGFLSCSLFLHMNFELKLLLLLLWLLASCSLFLHSHAWLSDCLVAHLYPTHNAQ
RPGVLKEPKLMGAISFFVFFFTLLALARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINREGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDTQQDSERSCSHLGTMV
EFAVALGAKLDIINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETARVLQSLGYTCYSRGVIKVKGKGQLRTYFLSTESARIGPNT
NT seq 3222 nt   +upstreamnt  +downstreamnt
atgccccggctcttcagtccccggcctccccccagcgaagatctcttctacgagacttat
tacagcctgagccagcagtacccgctgttgctactactgctagtcatcgtgctttctaca
cttctggctctgcttacggtcacatgggccagcggtcgggcgctgggctcagacccagcc
ttcctagctggagtgctctgcgcactagggggctttgcgctcctgctctgcttggcttcc
cgggagcagagactgcagcgttggacccgcccggtatcagggctcgtgtgggccgcccta
ctggccctgggccacagtttcctgttcactggcggtgtggtcagcgcctgggaccaggtg
tcctttttcctcttcatcatctttacggtgtacaccatgctgcctctgggtatgcgggac
gcagctgtggccggctttgcctcttctctgtcccaccttctggtccttgggctgtacctt
gggccacagcctgtctcgcggcccccgcttctccctcagctggctgccaacgcggtcctg
ttcttatgcgggaatgcggcaggagcctatcacaaagcgctaatggagcgcgcacttcgg
gccacattccgagaggctctgagctccctgcactctaggaggcgattggattctgagaag
agacaccaggaacatctcttgctgtccatattgccggcttacttggccagagaaatgaag
gccgagatcatggctcggcttcaggctgggcaaggcccccgacctgaaggcaccaacaac
tttcacagtttgtacgtgaagaggcaccagggggtcagcgtgctgtatgctgacattgtt
ggcttcactcgactggccagcgaatgctctcccaaggaactggtgctaatgctaaacgaa
ctctttggcaaattcgatcagatcgccaaggagcacgagtgcatgcggattaagattctg
ggagactgttactattgtgtgtctggtttgccactctctctaccggaccacgcactcaac
tgtgtgcgcatggggctggacatgtgccgtgccatccggaagctgcgggcagccactgga
gtggatatcaacatgcgggtgggcgtgcactcgggcagcgtgctctgcggtgtcatcgga
cttcagaagtggcaatatgacgtctggtcccatgatgtcaccctggccaaccacatggag
gcaggaggagtgcctggtcgagtgcacatcacaggggcaaccttggccctgttgggaggg
gcttatgctgtggaagatgcagccccggggcatcgggacccttatcttcgggagcttggg
gagcccacttacctggtcattgacccaagggcagaagaggaagaagaagaggaagtaact
gcaggaggcccattgtctcctcctgaaggacccaaaatgcgtccatcacttctgatgacc
cgatacttggagtcctggggtgcagcgaagccttttgcccatctcagccacccagacagc
cctgtgcccgtttcaccccctcttccggaaaatgccttggcctccctgggccctcagagg
agcctggatcggaccagaactcctagaggacttgaggatgaactggacactggggatgag
aaattctttcaagtcatcgagcagcttaattcccagaaacagtggaaacgatccaaggac
ttcagcccattcaccttgtactttcgagagaaagagatggagaaggagtatcggctctca
gctctccctgccttcaagtattacgcagcttgtacctttctggttttcctctccaatttc
accattcagatgctggtggccaacaggcccccagctctgactgtcacttatggcatcatc
ttcatcctcttttgccttctcctcttcatctgcttctcagaacacatgacgagatgtgtc
ctgaaaggtcccaagtttctgcactggcttccagctctctcaggaacagtagccacaaga
cccggtcttcgagttgccctcggcaccaccaccatccttattgtcctcaccatggctatt
gtcaacctgttctttcagccagtgtccgactgctccttcccagcccacaattcctctgct
gctgctctcaatagctcctgggaaatctctggttccttgcctctcatcagcatcccgtac
tccatgcattgctgtgtgctgggtttcctctcctgctccctctttctgcatatgaacttc
gaactgaagctgctgctgctactgctctggttgctggcctcctgcagcctcttcttgcat
tcccatgcctggctatctgactgcctcgttgcccacctctacccgactcacaatgctcaa
aggcctggggtgctaaaggagcccaaactgatgggtgccatctccttcttcgtctttttt
ttcacccttctggctctggctcgacagaatgagtattattgccgattggatttcctgtgg
aaaaaaaagcttcgtcaagagcgagaggagacagagacaatggagaacctgactcgactg
ctgctggaaaatgtgttgcctgcacatgttgccccccagttcattggtcagaaccggcga
aatgaggacctctaccaccaatcctatgagtgtgtctgtgtcctctttgcttctgtccct
gacttcaaggaattttactctgagtccaacattaaccgcgaggggctagaatgtcttcgg
ctgctgaatgagatcattgcagattttgatgagctactctctaaacccaagttcagcggt
gtggaaaagatcaaaactattggcagcacatatatggcagctacagggttaaatgccacc
tctggacaggacacccagcaggactctgaacgaagttgcagccacctgggcactatggtg
gagtttgcagtggcactgggggccaagctggacatcatcaacaagcactcattcaacaac
ttccgtctgcgtgtggggttgaatcatgggccagtcgtggctggggtaattggagcacag
aaaccacagtatgatatctggggcaacactgtgaatgtggctagcagaatggagagcaca
ggggttttgggcaagatccaggtaactgaggaaacagcccgggtcctacagtctttgggc
tatacctgctatagtcgaggagtaatcaaggttaaaggcaaaggacagctccgcacctac
ttcctatccacagaatcggcacggattgggcccaatacttag

DBGET integrated database retrieval system