KEGG   Sarcophilus harrisii (Tasmanian devil): 100920512Help
Entry
100920512         CDS       T02286                                 

Gene name
BCO1
Definition
(RefSeq) beta,beta-carotene 15,15'-dioxygenase
  KO
K00515  beta-carotene 15,15'-dioxygenase [EC:1.13.11.63]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00830  Retinol metabolism
shr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100920512 (BCO1)
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.63  beta-carotene 15,15'-dioxygenase
     100920512 (BCO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65 DUF1251
Motif
Other DBs
NCBI-GeneID: 100920512
NCBI-ProteinID: XP_003757903
Ensembl: ENSSHAG00000007696
UniProt: G3W0D4
Position
1
AA seq 533 aa AA seqDB search
MDMIFGKNKKEHPEPLRAKIRGELPTWLHGTLLRNGPGMHTIGETTYNHWFDGLALLHSF
TIQNGEVHYRSKYLRSDTYNSNIEANRIVISEFGTMAYPDPCKNIFSKAFSYLSHTIPDF
TDNCLINIMKCGEDFYATTETNYIRKINPETLDTLEKVDYRNYANINVATSHPHYDAQGN
VLNLGTSIVDKGKTKYLVFKIPPTIPEKKKKKNNLKHLEVICSIPSRSLLNPSYYHSFGI
TENYIIFLEQPFKLDILKMATAYIRGTNWASCLTFHEEDKTYIHIIDRKTKRTLQTKFYA
DPMVVFHHVNAYEEENHIVFDVISYKDHSLYQLFYLANLNQFFEQNSKLTSTPTLKRFVI
PLQMDKDAEIGENLVKLESTTATALKEKDDQVYCQSEELCEGIELPRINYAYNGKKYRYI
YAAEVQWNPVPTKILKFDILTKSSLKWAEEHCWLAEPVFVPAPNAQQEDDGIILSVVIST
DSKKSPFLLILDAKRFTELARASVDVEIHLDLHGLFIPSGDSPEEQEGNVLRN
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggatatgatctttggcaagaacaagaaggaacatccagagcctttgagagccaaaatt
agaggtgagctgccaacttggcttcatggtactcttctacggaacggccctggcatgcac
accattggggagactacttataatcattggttcgatggtttggccttattacatagtttt
accattcaaaacggtgaagttcattaccgaagtaaatacctccgaagtgacacatacaat
tccaatattgaagccaacaggattgtgatatcagaatttggaactatggcttatccagat
ccttgcaaaaatatattttccaaagctttttcctacctatcccacactattccagacttc
accgataattgcctcatcaatatcatgaaatgtggggaggacttctatgctactacagag
acaaattatattaggaaaatcaatccagaaactctggataccttggagaaggttgattac
cgtaattatgcaaacataaatgtggcaacttctcatcctcactatgatgctcaagggaat
gtcctcaacttgggcacatccatcgttgacaagggaaaaactaaatatttggtgtttaag
atacctcccacaataccagagaaaaaaaagaagaaaaataacttaaaacacttggaagtc
atctgttccatcccatctcgctctcttctcaacccaagctactaccacagttttggaatt
actgaaaactacatcattttcctagagcagccctttaagttggatattttaaagatggcc
actgcctacattcgaggcacaaactgggcttcttgccttaccttccacgaagaagacaag
acttacattcacattattgatcgaaagacaaaacggaccctgcagaccaaattttatgct
gatcccatggttgtcttccatcatgtaaatgcctatgaagaagagaatcatatcgtgttt
gatgtcatttcctataaggaccacagtctttatcagctcttctacttggcaaacttgaat
caattctttgagcagaactctaaacttacttctacaccaaccctcaagagatttgtcatt
cctctccagatggacaaggatgcagaaataggtgagaatttagtcaaacttgaatcgaca
acagcaactgctctgaaggaaaaagatgaccaagtctactgccaatcagaagagctatgt
gaagggattgagctgccccgtattaactatgcttacaatgggaaaaagtacagatacatt
tatgcagcagaagtacagtggaatccagttccaacaaagatattgaaatttgatattctg
acaaagtcatcattgaaatgggcagaggagcactgttggcttgctgagcccgtgtttgtg
cctgcaccaaatgcacaacaagaagatgatggtattatattgtcagtggttatctccacc
gactccaagaaatcaccttttctgctgatattggatgcaaaacgatttacagaactggct
cgggcatcagttgatgtggaaatacatttggatctacatgggctattcattccctctggg
gattcgcctgaagagcaggagggcaatgtgcttaggaactaa

DBGET integrated database retrieval system