KEGG   Sarcophilus harrisii (Tasmanian devil): 100921183Help
Entry
100921183         CDS       T02286                                 

Gene name
TSPAN12
Definition
(RefSeq) tetraspanin-12
  KO
K17355  tetraspanin-12
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
KEGG Orthology (KO) [BR:shr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    100921183 (TSPAN12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin
Motif
Other DBs
NCBI-GeneID: 100921183
NCBI-ProteinID: XP_003771602
Ensembl: ENSSHAG00000012139
UniProt: G3WFJ4
Position
5
AA seq 305 aa AA seqDB search
MAREDSVKCLRCLLYALNLLFWLMSISVLAVSAWMRDYLNNVLTLTAETRVEEAVILTYF
PVVHPIMIAVCCFLIIVGMLGYCGTVKRNLLLLAWYFGSLLVIFCVELACGVWTYEQEVM
VPVQWSDMVTLKARMTNYGLPRYRWLTHAWNFFQREFKCCGVVYFTDWLEMTEMDWPPDS
CCVKEFPGCSKQANREDLSDLFQEGCGKKMYTFLRGTKQLQVLRFLGISIGVTQILAMIL
TITLLWALYYDRRDPGTDQMMSLKNDTSQHLSCHSVELLKPSLSRIFEHTTMANSFNTHF
EMEEL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggctagagaagattcggtcaagtgcctgcgctgtcttctctatgcccttaatctgctc
ttttggttgatgtccatcagcgtgttggcagtttctgcctggatgagggattatctgaat
aatgttctgactttaactgcagaaacaagggtagaggaggctgtcatcttaacttacttt
cctgtagttcatcccatcatgattgctgtctgctgtttccttatcattgtggggatgtta
ggatactgtggaacagtcaaaagaaatttgttgcttcttgcatggtactttggaagtttg
cttgtaattttctgtgtggagctagcctgtggtgtttggacctatgagcaggaagttatg
gtcccagtgcagtggtcagacatggtcactttgaaagctagaatgacaaactatggttta
cctagataccggtggctgactcatgcttggaacttctttcagagagagtttaagtgctgt
ggagtagtgtatttcacagattggctagaaatgacagaaatggactggcctccagactcc
tgctgtgttaaggagtttccaggatgttcaaagcaggcaaatcgtgaagacttaagtgac
ctttttcaagagggttgtgggaaaaaaatgtacaccttcttgagaggaaccaaacaactg
caagttctaagattcttgggtatctctattggagttactcagattctggcaatgattctc
actattaccctgctgtgggctttgtattatgacagaagagatcctgggacagatcaaatg
atgtccttgaagaatgacacctcacagcacctgtcatgtcattcagtggagctactgaaa
ccaagtctatccaggatctttgaacatacaaccatggcaaacagctttaatacacacttt
gaaatggaagagctgtag

DBGET integrated database retrieval system