KEGG   Sarcophilus harrisii (Tasmanian devil): 100922543Help
Entry
100922543         CDS       T02286                                 

Gene name
ABHD6
Definition
(RefSeq) monoacylglycerol lipase ABHD6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:shr00001]
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100922543 (ABHD6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:shr01002]
    100922543 (ABHD6)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100922543 (ABHD6)
Peptidases [BR:shr01002]
 Serine Peptidases
  Family S33
   100922543 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr DUF1057 Lipase FSH1 DLH Esterase Thioesterase
Motif
Other DBs
NCBI-GeneID: 100922543
NCBI-ProteinID: XP_003763002
Ensembl: ENSSHAG00000007204
Position
2
AA seq 337 aa AA seqDB search
MDPHLVSMFVIAGGTLAIPILAFVASFFLWPSVLIRIYYWYWRRTLGLKVRYVNYEDYQF
CYTYRGRPGTKPSLLMLHGFSAHKDMWLSVIKFLPKNLHLICVDMPGHEGTTRSSLDDLS
IDGQVKRIHQFVESIKLNRKPFHLVGTSMGGHVAGVYAAYYPSDVCSLTLVCPAGLHITT
ENAFVQQLKVLQEMSAVEKIPLIPSTPEEMANMLKLCSYVRFKVPHQLLQGLVDVRIPHN
DFYRKLFLEIVNEKSRYLLQENMEKIQVPTQVIWGKQDQVLDVSGADLLAKGISNCQVEL
LENCGHSVVMERPRKAAKLIVEFLSSMHNAASNKKQD
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggatcctcatttggtgagcatgtttgtcatagctggaggaacgttggccatccccatc
cttgcctttgtggcttcatttttcctgtggccctcggtgctgatcagaatctattactgg
tactggcgtcggaccctgggcttgaaggttcgctatgtcaactatgaagattaccagttc
tgctatacctaccggggccggcccggaaccaagccttccctcctgatgctgcacggcttc
tctgcccataaagacatgtggctcagtgtgatcaagttccttccaaagaaccttcatttg
atctgtgtcgacatgcctggccatgagggaaccacccgctcctccttggatgacttatcg
atagatggacaagtcaaaaggatacaccagtttgtggaaagcatcaagctgaacaggaag
cctttccacctggtgggcacttccatggggggccacgttgcaggagtgtatgctgcctat
tatccatcggatgtctgcagtctgacattggtgtgtcctgctggcctccacatcaccact
gagaacgcttttgtgcagcagctcaaggtgctgcaagaaatgtctgctgtggagaagatc
cccttaatcccgtcgaccccagaagaaatggccaacatgctgaagctctgctcctacgtc
cgcttcaaagtcccacaccagcttctacagggccttgttgatgttcgcattccacacaat
gacttctaccgaaagctgtttttggaaatcgtaaatgaaaagtcaagatacttactccag
gaaaacatggagaagatccaagttccaacacaggtcatctggggaaagcaagatcaggtc
ctggatgtgtctggagccgacttgttggccaagggaatctccaactgtcaggtggaactt
ctggagaactgtggccactcggtggtgatggaacggccccgaaaggcagccaagctcatc
gtggagttcttatcttccatgcacaacgcagccagcaacaagaagcaggactga

DBGET integrated database retrieval system