KEGG   Sarcophilus harrisii (Tasmanian devil): 100923159
Entry
100923159         CDS       T02286                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
KEGG Orthology (KO) [BR:shr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:shr03021]
    100923159 (AFF3)
Transcription machinery [BR:shr03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     100923159 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 100923159
NCBI-ProteinID: XP_031819487
Position
3
AA seq 1333 aa
MDSFDLALLQEWDLESLCVYEPDRNVLRRKERERRNQETQQDDGAFSTSYSLFSEPYKTN
KGDELSNRIQNTLGSYDEMKDFLTDRSNQSHLVGVPKPGVPQTPMNKIDEHFIADSRSQP
QPPICSTSSSTPAAVPVQQSKRVTMGWQKVGHPTSDGQQRASKHGHRLLDSHNSDFKSAN
QKTSNEKPKHCVSSPTSSSSSSSSSSSSSNSAQPGPPRTMLGDAVSRQQSRSKQSCSVEM
GLQPQERNSAMSAKHSGGGHCVQNFPPSLASKPSLIQQKPTAYVRPMDGQDQAPDESPKL
KSSTETSVHCTSYRGVPVNKAESSRTKSKLAKFNIPKQGEDSGSGDNSCVEEILREMTHS
WPPPLSAIHTPGKLEPSKFSFPNKDSQHVSTGHNNPKKNDAEPKSPDNGTSNTSMLEDDL
KLSSDEEENEQQAAQRSALRVLSDSAVVQQQSNSRPSGPSSKGSSSGSSSSSSSSSSDSE
SSSGSDSESESSSSGSEGSKPSHYSSPEPEQASSNKWQLDKWLNKVNPHKPPLLNQNENH
GSESSQYYSRGKEEVQECGKLATLCQPGVREKEIKNACKEEQRPRTANKAPGTKGVKQKS
PPATAPAPPAAAAAAPTAPPAAPASVSAVLSAGPTGVIPIAAESAGAPAPSRRSACKKPP
RRTATATERASAVDGANCHRPPAEELAASEVLVESPTPDPPKPRPCAGGGGGGGGARTGH
RKELRSCASSVAAATACEKRRTRGLSKTAPKSKEFIETESSSSSSSSSSSSDSEPESEPE
DYSGPKPPPVGPGSAAAAAAPSAGGDQRLREGAGPGTGGNSNKAVGSINARTSSDAAKEL
EEQFYTLVPFGRNELLSPLKDNDEVKALWVKIDLALLSRIPEPSPPLDPPPAAPAAPAAK
DSDPGPQSHAPDLQTAEKGLPKSKRKRKCENEEEFREVKKTQGEKECSSRLTTLANSTSS
TSHCHLNTNSLAIPINKNEKMLRSPISPLSDVSKHKYSNDDLTSSSRPNGSSLFTSISSS
KKHKTENQLQPHAGDLAKTVHNNSENSLFYNKPRPQTEPWSPLSNGHRDCRRQKLIFDDM
PRSADYFMQEAKRMKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYS
ETVELIRYAMRLKTHSGPNATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDY
FKNSSKAAQAPSPWSASGKSTGTPSPMSPSPSPVSSVGSQGSLSSTSTPSPSSIISIPHR
IHQMAANHVSITNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQ
QGLHWLRNSVHSS
NT seq 4002 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttagccctgcttcaggaatgggacttggagtctctgtgtgtctat
gaaccagacagaaatgtattacggagaaaagaacgggaaaggagaaatcaggaaactcag
caagatgatggagcatttagtacaagttactccctcttcagtgaaccttacaagactaac
aagggggatgagctctcaaatcggatccagaatactttaggcagttatgacgaaatgaaa
gacttcttgactgaccgatccaatcagagtcaccttgttggggttcccaaacctggggtt
ccacagacccctatgaacaaaatagatgagcatttcattgctgactcaagatcgcagccc
cagcctcctatctgcagcacatcatcttccacaccagcagctgtacctgtgcagcagagc
aagagggtcaccatgggctggcagaaagttgggcatcctacatctgatggccagcagagg
gcaagcaagcatgggcatagattgcttgattcacacaatagtgacttcaaatctgctaac
caaaaaaccagtaatgagaaacctaaacactgtgtctcaagccccacatcctcctcctct
tcttcctcttcttcttcttcctcctccaactcagcacaaccaggacctccaaggaccatg
cttggagacgctgtcagcaggcaacagtcaaggtccaagcagagctgcagtgtggaaatg
ggtcttcaacctcaagaaaggaactctgccatgtctgccaaacacagcggtggtgggcac
tgtgtccagaacttccctccttctcttgcttccaaaccaagtctaatccagcagaaacca
actgcttatgttcggccgatggatggccaagaccaggcccctgatgaatctcctaaactc
aagtcttcaacagaaactagtgtacattgtacctcctacagaggagtacctgtcaataaa
gctgaatcatccaggaccaagtccaagttagcaaaatttaacattcccaaacaaggggag
gacagtggatcaggcgataacagctgtgttgaagaaatattacgggagatgacccattcc
tggcctccacctctttctgctattcacacccctggtaaattagaaccaagcaaattttca
tttccaaataaggactctcagcatgtatccactggacacaacaatccaaagaaaaatgat
gctgagccaaagagtccggacaatggtacatcaaatacttcaatgctagaagatgacctt
aaattaagtagtgatgaagaagaaaatgagcagcaggccgcacagagatctgctctccgc
gttctgtctgacagcgcggtggttcagcagcagtccaatagcagaccctcgggcccctcc
agcaaagggtcgagcagcggcagctccagcagcagcagcagcagctccagcgactcggaa
agcagctccggctccgactcggagagcgaaagcagctccagtggaagtgaaggcagcaag
ccttctcactactccagcccagagccagaacaagcttcttccaacaagtggcagctggat
aaatggctcaacaaagtgaatccccataagcctccgctcctgaatcaaaatgaaaaccac
gggtcagagagcagccagtactacagccggggaaaggaggaggtgcaagagtgcgggaaa
ttagccaccctctgccagccaggcgtccgggagaaggagatcaagaacgcctgcaaagag
gagcagaggcctaggactgctaacaaggccccggggactaaaggggtgaagcagaagtcg
cctcccgccactgcgcctgcgcctcccgcagccgctgccgccgcccccacagcgccccct
gccgccccggcctctgtctccgctgttctgagtgccgggcccacgggggtcattccgatt
gctgcggaaagcgcaggcgcgccggccccttcccggaggtcggcctgcaagaagcctccg
aggaggaccgcgacagccacggagagggcctcggccgtcgacggcgctaactgccaccgg
ccgccggccgaagagctggcggccagcgaggtgctagtggagagccccacccccgacccc
ccaaagcccaggccttgcgccggcggcggcggcggcggcggcggcgctaggacgggtcac
cgaaaagagctgcgctcgtgcgcgtcctcggtagcggcggccacggcctgcgagaagcgc
cgcacgcggggcctgagcaagacggcccccaagtccaaggaattcatcgagactgagtct
tcgtcctcttcttcgtcctcgtcgtcctcgtccgactcggagccagaatcggagcccgag
gactactcgggccccaaacccccgcccgtgggcccgggctccgcggcggcggcggcggcg
ccctcggcggggggcgaccagcggctccgggagggcgcgggccccggcaccggcggcaac
agcaacaaggccgtgggctccatcaacgccaggacctcgagcgacgccgccaaggagcta
gaagagcagttctacactctggtgcccttcggccgcaacgagctgctctccccgctcaag
gacaatgacgaggtgaaggccctttgggtcaaaatcgatctggccctcctctcccgcatc
ccggagccctcgccccccctggaccctccccctgctgccccagccgcccccgcggccaaa
gactcggatcctggcccgcagagtcacgccccagacctgcagacggccgagaagggtttg
ccgaagtccaagcggaaacgcaagtgtgaaaatgaggaggaatttagggaagtcaagaag
actcagggagagaaagagtgttcctcacgactgactactttggccaacagtacttcttcg
acaagccattgccacttgaacaccaatagcttggcaataccaataaataaaaatgagaaa
atgcttcggtcacccatttcacccctctcagatgtgtcaaaacacaaatactccaatgat
gatttaacttcttccagtagacctaatggcagcagtctgttcacttccatctcctccagc
aaaaagcataagacggagaatcagttgcagccccatgctggagaccttgctaaaacagtg
cacaacaactcagaaaacagtctcttctataataaaccacgaccccagacggaaccatgg
tcaccattatccaatgggcacagagactgcagaagacaaaagctcatctttgatgatatg
ccacgcagtgcagattattttatgcaagaagcaaaacggatgaaacataaagcagatgca
atggtggaaaaatttggaaaagctttgaattatgctgaagcagctctgtcatttattgaa
tgtggaaatgcaatggagcaaggtccaatggaatctaaatctccctatacaatgtattca
gaaacagtagaactcatcaggtacgctatgagactaaaaactcactcaggcccaaatgcc
actccagaggacaaacaattagctgcattatgttatcgctgtctggctctcctgtattgg
cgaatgtttcgactcaaaagagaccatgctgtaaaatattcaaaagcacttattgactat
ttcaagaattcatctaaagctgcccaggccccatctccatggagtgccagtggaaagagc
acgggaactccatcccccatgtctcccagcccttctccagtcagctcagtgggatctcag
gggagtctttccagcactagcaccccttcaccatcatccataattagcattccacatcgg
atccatcagatggcagccaaccacgtcagcatcaccaacagcattctgcacagctacgac
tactgggagatggctgacaaccttgccaaggagaacagagagttctttaatgacctggat
ttgctgatggggcctgtcaccctgcatagcagtatggaacacctagttcagtactcccag
caaggactacattggctgcgaaatagtgttcactcatcatag

DBGET integrated database retrieval system