KEGG   Sarcophilus harrisii (Tasmanian devil): 100924507Help
Entry
100924507         CDS       T02286                                 

Gene name
MGST1
Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00480  Glutathione metabolism
shr00980  Metabolism of xenobiotics by cytochrome P450
shr00982  Drug metabolism - cytochrome P450
shr00983  Drug metabolism - other enzymes
shr01524  Platinum drug resistance
shr05200  Pathways in cancer
shr05204  Chemical carcinogenesis
shr05225  Hepatocellular carcinoma
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100924507 (MGST1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100924507 (MGST1)
   00982 Drug metabolism - cytochrome P450
    100924507 (MGST1)
   00983 Drug metabolism - other enzymes
    100924507 (MGST1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100924507 (MGST1)
   05204 Chemical carcinogenesis
    100924507 (MGST1)
   05225 Hepatocellular carcinoma
    100924507 (MGST1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100924507 (MGST1)
  Drug resistance
   01524 Platinum drug resistance
    100924507 (MGST1)
Enzymes [BR:shr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100924507 (MGST1)
Transporters [BR:shr02000]
 Other Transporters
  Pores ion channels [TC:1]
   100924507 (MGST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 100924507
NCBI-ProteinID: XP_003772588
Ensembl: ENSSHAG00000001960
UniProt: G3VGA0
Position
5
AA seq 155 aa AA seqDB search
MAEFPQLSDNQTFLAFISYSTIVISKMMLMSIITSFFRITRKAYANPEDALASGKGENAK
KFLRTDDRVERVRRAHLNDLENIIPFFCIGLLYSLSNPDFSTAVWHFRLFVAARIFHSIA
YLTPLPQPNRGLSWMIGYGVTFSMAYRLLKNKLYL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatttccccagctgagtgacaaccagactttcttggcttttatctcctattca
accattgtcatttcaaaaatgatgctaatgagtattataacatcattcttcagaataaca
agaaaggcttatgccaatccagaagatgccctagcctcaggtaaaggggagaatgctaag
aagtttcttcggacagatgatagagttgaacgtgtacgcagagcacacctgaatgatctt
gaaaatatcatcccattcttctgtattggcctgctatattccctgagtaatccagacttt
tccacagctgtatggcacttcagactctttgttgcagccagaatcttccactcaatcgct
tatttgacacctcttccacagccaaatcgtgggctgagttggatgattggatatggagtt
actttttcaatggcatacagattgttaaagaacaaattatacttgtaa

DBGET integrated database retrieval system