KEGG   Sarcophilus harrisii (Tasmanian devil): 100924804
Entry
100924804         CDS       T02286                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
KEGG Orthology (KO) [BR:shr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:shr01002]
    100924804 (ERAP1)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     100924804 (ERAP1)
Peptidases and inhibitors [BR:shr01002]
 Metallo peptidases
  Family M1
   100924804 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N FPV060
Other DBs
NCBI-GeneID: 100924804
NCBI-ProteinID: XP_031823795
Ensembl: ENSSHAG00000002526
Position
1
AA seq 1027 aa
MSEHIPCNLSRAPISEATDAPGKSVGSRSPPGPSLFSLVATFTFSPTFRGLGCEGRAWDR
GLRPQKLRHKPAGSASRVCDFRSKNKMAFFPLKLPLKTASSFFPSLLTIWIMMASMNCHG
MDINSPKATNGAPFPWNKMRLPDYIFPVHYDLMIHANLTTLTFLGTTEIEITVNQPTSFI
ILHSQNLQITRATLREKSQDSTVEQPVTVLEYPPNEQIAILANKPLLMGHQYIVKIEYSA
FLSETFHGFYKSSYRTQKGEVRILASTQFEPTSARMAFPCFDEPAFKAKFSVRIRRDPKH
LALSNMPLMKSMNIDEGLIEDYFDVTVKMSTYLVAFIISDFESVSKMTKSGIKVSVYTIP
EKINQSGYALDTAVTLLDFYEDYFNIPYPLPKQDLVAIPDFQSGAMENWGLTTYRESGLL
YDTEKSSASSRLGITMVIAHELAHQWFGNLVTMEWWNDLWLNEGFAKFMEFVSVNVTHPD
LKVEEYFFGKCFQAMEVDALNSSHPVSTPVENPAEIREMFDDVSYEKGACILNMLKDYLN
ADVFRTGIVQYLRKYSYKNTKNEDLWNTMTNICPTGDIQKTGEFCPRNQPTSSTLHWSQE
VVDVKAMMNTWTLQKGFPLVTVTMKGKNVHIKQELYRKGVNHSVETGYLWHIPLSYITSK
SDKVEKVLLRTKTDVIILPEEVEWIKFNMGMSGYYIVHYENDGWQSLTGLLKEKHMMFSS
NDRASLINNAFQLVSIGKLSIEKALDLSLYLKHETEIMPVFQGLNELIPLYKLMEKRDMV
DVETQFKAFLIRLLKNLIDKQTWTDDGSVSQRMLRSQLLLFACMREYQPCVQKAEDYFKK
WKESNGNFSLPNDVTSAVFAVGAQTTEGWDFLYRKYQFSLSSTEKNKIELALSFSHDKEK
LQWLLEQSFEGNIIKTQEFPTILHYVARNPKGYLLAWKFLKENWNKIIEKFELGSTTVSH
MVMGTTNQYSTREQFEEVQEFFSSLKEKGSQLRCVQQALETIKENIRWMNQNFEKIRVWL
QKSVTLF
NT seq 3084 nt   +upstreamnt  +downstreamnt
atgtctgaacatatcccttgcaacctctcaagggcgcccatctcagaggccactgatgct
ccaggaaagagcgtaggcagccgcagccctcctgggccttccctcttctctctagttgct
actttcactttcagtcccacgtttagaggcctgggctgcgaaggacgcgcgtgggaccgc
gggctccggccccagaaactcaggcacaagcccgccgggtctgcatcgagggtctgtgat
tttaggagcaagaacaagatggcttttttcccacttaaattgccacttaagactgcatca
tctttttttccttcactgttgactatttggattatgatggcttctatgaattgccacggc
atggacataaactctccaaaagctactaatggagctccatttccttggaataagatgcgg
cttcctgattacatctttccagttcattatgatctgatgatccatgctaatctcaccact
ttgacattcttgggaaccactgaaatagaaatcaccgtcaatcagcccaccagtttcatt
attctacatagtcaaaacctgcagatcaccagggccaccctccgagaaaaaagccaagat
agtacagtagaacaaccagtgactgttctagagtatccacccaatgagcaaattgcaatt
ctagccaataaacctcttctgatgggacatcagtacatcgttaaaattgaatattctgcc
tttctttctgaaactttccatggattttataaaagttcctatagaactcagaagggagaa
gtgagaatattagcgtctacacagtttgaaccaacatcagctcggatggcctttccctgc
tttgatgagccagcctttaaagcaaaattttcagtcaggattagaagagatccaaagcac
cttgcgctctctaacatgccattaatgaaatccatgaatattgatgaaggactaatagaa
gactactttgatgtcactgtgaagatgagcacttaccttgttgcttttattatttccgac
tttgaatctgtcagcaaaatgactaaaagtggaatcaaggtttctgtgtatactatacca
gagaagataaaccagtcaggttatgctctggatactgcagtgactcttctggacttttat
gaggattatttcaatattccatatcctttacccaaacaagatcttgttgccatccctgac
tttcagtctggtgccatggaaaactggggattgacaacatacagagaatctggactgttg
tatgacacagaaaaatcctctgcttccagtagacttgggatcaccatggtaatagctcat
gaactggcccaccagtggtttgggaatcttgtcaccatggaatggtggaatgatctttgg
ctaaatgaaggatttgcaaagtttatggagttcgtgtctgtcaatgtgacccatccagat
ttgaaagttgaagaatatttctttggaaaatgttttcaggccatggaagtagatgcatta
aattcttctcatcctgtctccacaccagtggagaatcctgctgagattcgcgaaatgttt
gatgatgtttcttatgaaaagggagcttgtatattgaatatgctaaaggactatcttaat
gcagatgtattcagaactggcattgtgcagtatctccggaaatacagttataagaacacc
aaaaatgaagatctgtggaacactatgacaaatatttgtcccacaggtgacatacaaaag
acaggtgaattttgcccaagaaaccaacccacatcctcaaccttgcactggagccaagaa
gttgtcgatgtgaaagccatgatgaacacatggacgctacagaaagggtttccactggtc
actgtcaccatgaaaggaaagaatgttcatataaagcaagaactctataggaagggagtc
aatcactctgtggaaactgggtacttgtggcatattccattgtcatacattaccagcaaa
tcagacaaagttgaaaaagttttgctgagaacaaaaacagatgttatcatcctcccagaa
gaggtggaatggatcaaattcaacatgggaatgtctggctattatattgtacattatgag
aatgatggatggcaatctttgactggccttttaaaagaaaagcacatgatgttcagcagc
aatgatcgagcgagtcttattaacaatgcatttcagcttgtcagcattggaaaattatcc
attgaaaaagctttggacttatccctgtacctgaaacatgagactgaaattatgcctgtg
ttccaaggtttgaatgagctgattcctttgtataagttaatggagaaaagagatatggtt
gatgtagaaactcaatttaaggctttcctcatcaggttgcttaagaacctcattgacaag
caaacatggacagatgatggctcagtctcacagaggatgctgcgcagccaactccttttg
tttgcttgtatgagagagtatcaaccttgtgttcagaaggcagaagactatttcaagaaa
tggaaagaatccaatggaaattttagtttaccaaatgacgtgacctccgcagtgtttgct
gttggggcacagaccacagaaggctgggattttctctataggaagtatcagttctctttg
tccagtactgagaaaaacaaaattgaactggccctctcttttagccatgataaagaaaaa
cttcaatggttactggagcagagttttgaagggaatataataaaaactcaggagtttcca
actattcttcattatgttgccagaaatccaaagggttatctcttggcttggaaatttttg
aaagaaaattggaataaaatcatagagaagtttgaacttggctcaactactgtaagccac
atggtgatgggaaccacaaatcaatactctacaagagagcaatttgaagaggtgcaagaa
tttttcagctccctgaaggaaaaaggttcccagcttcgttgtgtccagcaagcacttgaa
acaattaaagaaaacatacgctggatgaatcagaattttgagaaaatcagagtgtggtta
caaaaaagtgtcaccttattttaa

DBGET integrated database retrieval system