KEGG   Sarcophilus harrisii (Tasmanian devil): 100924973Help
Entry
100924973         CDS       T02286                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00010  Glycolysis / Gluconeogenesis
shr00562  Inositol phosphate metabolism
shr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100924973 (MINPP1)
   00562 Inositol phosphate metabolism
    100924973 (MINPP1)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100924973 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100924973 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 His_Phos_1 DUF4708
Motif
Other DBs
NCBI-GeneID: 100924973
NCBI-ProteinID: XP_023351178
Ensembl: ENSSHAG00000004189
Position
1
AA seq 346 aa AA seqDB search
MDGQLVEKGRRDMRLLAARLAARFPALLSRADLARARLVTSSKPRCVDSAVAFARGLWAQ
LHPGLPEPEPEDMEFGPPKINDKLMRFFDHCEKFQVEVEKNDSALHHVEAFKNGPEMQEI
IKKVAAILQVPTSDLNADLIQVAFFSCSFDLAIRDIQSPWCDVFDTDDAKVLEYLNDLKQ
YWKRGHGYTINSRSSCSLFQHIFRHLDEAVEQRQRSQPISSPAVFHFGHAETLLPLLSLM
GYFKDKEPLTAHNYKEQTQRQFRSGHIVPYAANLIFVLYHCERPETPAREYQVQLLLNEE
PLPFVHSAETVATYQELKEHYRDVLQSCRSDRDCTVPSINITSDEL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggacgggcagctggtggagaagggccgccgcgacatgcgcctgctggccgcccgcctg
gccgcgcgcttccccgcgctgctcagccgcgccgacctggcccgcgcgcgcctcgtgacc
agctccaagccgcgctgcgtggacagtgccgtggccttcgcgcgcggcctctgggcgcag
ctgcacccgggcctcccggagcccgagcccgaagatatggaatttgggccacctaagata
aatgataaacttatgaggttctttgatcattgtgaaaagttccaagttgaggtggaaaag
aatgattcagctcttcatcatgtagaagccttcaaaaatggaccagaaatgcaggaaatt
attaaaaaagttgcagctattttgcaggtgccaacaagtgatttaaatgcagatttaatc
caagttgcttttttttcctgttcatttgacctggctattagagacattcagtccccctgg
tgcgatgtctttgacacagatgatgctaaggtgctggaatacctgaatgacctaaagcag
tattggaagagagggcatggctacacgatcaatagtcgatccagttgcagcctctttcag
cacatttttcgtcatttggatgaagctgttgaacagagacaaaggtcccagcccatctcc
tccccagccgtcttccacttcggacacgcggagacgctgctgccgctgctctctctgatg
ggctactttaaggacaaggagcccctcacggctcacaattacaaggagcagacgcagcgc
cagttccggagcggccacatcgtcccctacgcggccaatctcatatttgtgctttaccac
tgcgagcgccctgagacgccggcccgcgagtaccaggtgcagctgctcctgaacgaggag
ccgctgcccttcgttcactccgccgagactgtcgccacatatcaggagctgaaggagcac
taccgggacgtcctgcagagctgccgctcggaccgggactgcaccgtgcccagtatcaac
atcacctctgatgagctgtga

DBGET integrated database retrieval system