KEGG   Sarcophilus harrisii (Tasmanian devil): 100924992Help
Entry
100924992         CDS       T02286                                 

Gene name
LYPLA1
Definition
(RefSeq) acyl-protein thioesterase 1
  KO
K06128  lysophospholipase I [EC:3.1.1.5]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00564  Glycerophospholipid metabolism
shr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100924992 (LYPLA1)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    100924992 (LYPLA1)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100924992 (LYPLA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 Hydrolase_4 Abhydrolase_1 Abhydrolase_3 Abhydrolase_6 FSH1 Cutinase DUF2974 DLH Esterase Lipase_3 DUF2920 AXE1 PAF-AH_p_II
Motif
Other DBs
NCBI-GeneID: 100924992
NCBI-ProteinID: XP_023354409
Ensembl: ENSSHAG00000000835
Position
2
AA seq 230 aa AA seqDB search
MCGNNMSAPLPAIVPAARKASAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVMP
VTLNMNMAMPSWFDIIGLSPDSQEDEQGIKQAAENIKALIDQEVKNGIPSHRIVLGGFSQ
GGALSLYTALTTQQKLAGVIALSCWLPLRSSFSQGPINGVNKDISILQCHGDCDPLVPHM
FGSLTVEKLKTLVNPSNVSFRTYEGMMHSSCNQEMLDVKQFVDRLLPPVD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtaacaacatgtcggcgccgctccctgccatagtgcccgcagccaggaaggca
agcgccgcggttatttttcttcatggattaggcgatacggggcatggatgggcagaagct
tttgcaggtatcagaagttcacatattaaatatatttgtccacatgcaccagttatgcct
gttaccctaaatatgaacatggctatgccttcttggtttgatattattggtctttctcct
gactcacaggaggatgagcagggaataaaacaagctgcagaaaatattaaggctttaata
gatcaagaagtgaagaatggaattccatctcataggattgttttgggagggttttctcag
ggaggagctttgtctttgtatactgctcttacaacacagcaaaaattggctggtgttata
gctctcagctgttggcttccacttcgatcttcattttcacagggtcctataaatggggtt
aataaagatatttctattctccagtgtcatggagactgtgaccctttggttcctcatatg
tttggttctctcactgttgaaaagctaaaaacactggtaaatccttctaatgtaagcttc
cgtacctatgaaggcatgatgcacagttcatgtaatcaggaaatgttggatgtcaagcaa
ttcgttgatagactcctacctccagttgactga

DBGET integrated database retrieval system