KEGG   Sarcophilus harrisii (Tasmanian devil): 100925447Help
Entry
100925447         CDS       T02286                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01522  Endocrine resistance
shr04010  MAPK signaling pathway
shr04015  Rap1 signaling pathway
shr04068  FoxO signaling pathway
shr04071  Sphingolipid signaling pathway
shr04218  Cellular senescence
shr04261  Adrenergic signaling in cardiomyocytes
shr04370  VEGF signaling pathway
shr04380  Osteoclast differentiation
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04611  Platelet activation
shr04620  Toll-like receptor signaling pathway
shr04621  NOD-like receptor signaling pathway
shr04622  RIG-I-like receptor signaling pathway
shr04625  C-type lectin receptor signaling pathway
shr04657  IL-17 signaling pathway
shr04658  Th1 and Th2 cell differentiation
shr04659  Th17 cell differentiation
shr04660  T cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04668  TNF signaling pathway
shr04670  Leukocyte transendothelial migration
shr04714  Thermogenesis
shr04722  Neurotrophin signaling pathway
shr04723  Retrograde endocannabinoid signaling
shr04728  Dopaminergic synapse
shr04750  Inflammatory mediator regulation of TRP channels
shr04912  GnRH signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04917  Prolactin signaling pathway
shr04926  Relaxin signaling pathway
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr05014  Amyotrophic lateral sclerosis (ALS)
shr05132  Salmonella infection
shr05133  Pertussis
shr05140  Leishmaniasis
shr05142  Chagas disease (American trypanosomiasis)
shr05145  Toxoplasmosis
shr05152  Tuberculosis
shr05160  Hepatitis C
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05167  Kaposi's sarcoma-associated herpesvirus infection
shr05169  Epstein-Barr virus infection
shr05205  Proteoglycans in cancer
shr05418  Fluid shear stress and atherosclerosis
Module
shr_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100925447 (MAPK13)
   04010 MAPK signaling pathway
    100925447 (MAPK13)
   04370 VEGF signaling pathway
    100925447 (MAPK13)
   04668 TNF signaling pathway
    100925447 (MAPK13)
   04068 FoxO signaling pathway
    100925447 (MAPK13)
   04071 Sphingolipid signaling pathway
    100925447 (MAPK13)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    100925447 (MAPK13)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100925447 (MAPK13)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100925447 (MAPK13)
   04620 Toll-like receptor signaling pathway
    100925447 (MAPK13)
   04621 NOD-like receptor signaling pathway
    100925447 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    100925447 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    100925447 (MAPK13)
   04660 T cell receptor signaling pathway
    100925447 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    100925447 (MAPK13)
   04659 Th17 cell differentiation
    100925447 (MAPK13)
   04657 IL-17 signaling pathway
    100925447 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    100925447 (MAPK13)
   04670 Leukocyte transendothelial migration
    100925447 (MAPK13)
  Endocrine system
   04912 GnRH signaling pathway
    100925447 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    100925447 (MAPK13)
   04917 Prolactin signaling pathway
    100925447 (MAPK13)
   04926 Relaxin signaling pathway
    100925447 (MAPK13)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100925447 (MAPK13)
  Nervous system
   04728 Dopaminergic synapse
    100925447 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    100925447 (MAPK13)
   04722 Neurotrophin signaling pathway
    100925447 (MAPK13)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100925447 (MAPK13)
  Development
   04380 Osteoclast differentiation
    100925447 (MAPK13)
  Environmental adaptation
   04714 Thermogenesis
    100925447 (MAPK13)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100925447 (MAPK13)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100925447 (MAPK13)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100925447 (MAPK13)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100925447 (MAPK13)
  Infectious diseases
   05132 Salmonella infection
    100925447 (MAPK13)
   05133 Pertussis
    100925447 (MAPK13)
   05152 Tuberculosis
    100925447 (MAPK13)
   05164 Influenza A
    100925447 (MAPK13)
   05160 Hepatitis C
    100925447 (MAPK13)
   05163 Human cytomegalovirus infection
    100925447 (MAPK13)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100925447 (MAPK13)
   05169 Epstein-Barr virus infection
    100925447 (MAPK13)
   05145 Toxoplasmosis
    100925447 (MAPK13)
   05140 Leishmaniasis
    100925447 (MAPK13)
   05142 Chagas disease (American trypanosomiasis)
    100925447 (MAPK13)
  Drug resistance
   01522 Endocrine resistance
    100925447 (MAPK13)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100925447 (MAPK13)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100925447 (MAPK13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH RIO1 Kinase-like Kdo Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 100925447
NCBI-ProteinID: XP_003769048
Ensembl: ENSSHAG00000005652
UniProt: G3VTJ1
Position
4
AA seq 366 aa AA seqDB search
MSFIRKKGFYKQEVNKTAWELPKTYVNLTHVGSGAYGSVCSAIDKKSGEKVAIKKLSRPF
QSEIFAKRAYRELMLLKHMQHENVIGLLDVFTSATSLHNFHDFYLVMPFMQTDLQKIMRM
EFSEDKIQYLVYQMLKGLKYIHSSGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQIMKVTG
VPGADFVQKLQDKAAKSYIQSLPQCPKKDFSQFFPRASPQAVDLLEKMLELDVDKRLTAT
QALAHPFFDQFRDPEEETVAQQPFDDSMEHEKLTVDEWKSHIYKEVSNFSPIARKDSRRR
SLMKLQ
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcatccggaaaaagggcttttacaagcaagaagtgaacaagactgcctgggag
ctgcccaagacctacgtgaacctgacccacgtgggcagcggggcctacggatctgtgtgc
tcagccattgataagaagtcaggagagaaggtggcaatcaagaaactgagccgacctttc
cagtcagagatctttgctaaaagagcctatcgggagctgatgttattgaaacacatgcag
catgagaatgttattggactcttggacgtctttacttcggctacctccctgcacaacttc
catgatttctatctggtgatgccatttatgcagactgatcttcagaagataatgcgcatg
gaattcagtgaagataaaatccaataccttgtctatcagatgctgaaggggcttaagtat
atccactcttctggggtcgtccacagggacttgaaaccaggaaacttggctgtgaatgaa
gactgtgaactgaagatcctagattttgggttggccaggcatgcagatgctgaaatgacg
ggctatgtggtaacacgttggtaccgggccccagaagtgattctcagctggatgcactat
aatcagacagtggacatctggtctgttggatgcatcatggcagagatgctgactgggaaa
actctgttcaaaggaaaagactatttggaccaactgacccagatcatgaaggttaccggg
gttcctggagcagactttgtacagaaattacaggacaaagcagccaaatcctatatccag
tctctgcctcagtgtcccaagaaggatttctcacaatttttccctcgtgctagtccccag
gctgtggatctgttagagaagatgcttgagttggatgtggacaagcgcttgacagctaca
caggctctcgcccatcccttctttgaccaattccgggatccagaggaagagacggtagcc
cagcagccatttgatgattccatggaacatgagaagctcacagtggatgaatggaagagt
cacatctataaggaggtttcaaattttagtcctatagcacggaaggactccaggagaaga
agtctcatgaaactacaatga

DBGET integrated database retrieval system