KEGG   Sarcophilus harrisii (Tasmanian devil): 100925990Help
Entry
100925990         CDS       T02286                                 

Gene name
USP46
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 46
  KO
K11842  ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100925990 (USP46)
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100925990 (USP46)
Ubiquitin system [BR:shr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100925990 (USP46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 Peptidase_C98
Motif
Other DBs
NCBI-GeneID: 100925990
NCBI-ProteinID: XP_023361769
Ensembl: ENSSHAG00000017164
Position
6
AA seq 366 aa AA seqDB search
MTVRNIASICNMGTNASALEKDIGPEQFPINEHYFGLVNFGNTCYCNSVLQALYFCRPFR
ENVLAYKAQQKKKENLLTCLADLFHSIATQKKKVGVIPPKKFISRLRKENDLFDNYMQQD
AHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEPVENNKPELTWVHEIFQGTLTNET
RCLNCETVSSKDEDFLDLSVDVEQNTSITHCLRDFSNTETLCSEQKYYCETCCSKQEAQK
RMRVKKLPMILALHLKRFKYMEQLHRYTKLSYRVVFPLELRLFNTSSDAVNLDRMYDLVA
VVVHCGSGPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESGYIL
FYQSRE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgactgtccgaaacatcgcctccatctgtaatatgggcaccaatgcctctgctctggaa
aaagacattggtccagagcagtttccaatcaatgaacactattttggattggtcaacttt
gggaacacatgctactgtaactctgtccttcaagcattgtacttctgtcggccatttcga
gaaaatgtattggcgtacaaggcccagcaaaaaaagaaggaaaatctgttgacttgcctg
gcagacctttttcatagtattgctactcagaagaaaaaagttggcgtgattccaccaaag
aagttcatttcaaggttaagaaaggagaatgatctctttgacaactacatgcagcaggat
gcccatgagtttttaaattatttgctaaacactattgcagacatcctgcaggaggagaaa
aagcaggaaaaacaaaatgggaagttaaaaaatggcaacatgaatgaacctgtggagaac
aataagccagaactcacttgggtacatgaaatctttcagggaacgttgaccaatgaaacc
cgatgcttgaactgtgaaactgttagtagcaaagatgaagattttcttgacctttctgtt
gacgtggaacagaacacatcaatcacacactgtctaagagacttcagtaacactgagaca
ttgtgtagtgaacagaaatactactgtgaaacttgctgcagtaaacaggaggcccagaaa
aggatgagagtaaaaaagcttccaatgatcctagcattacatcttaagaggttcaaatat
atggaacaactccacagatataccaagctctcctaccgtgtggtcttcccgctggagctc
cgtctgttcaatacatccagtgacgcagtgaacctggaccgcatgtatgacttggtggct
gtagtagtccactgtggcagtggacctaatcgtgggcattatattaccattgtgaagagt
catggcttctggcttttatttgatgatgacattgtagagaaaatagatgcacaagctatc
gaagaattctatggtctgacatcagatatatcaaaaaattcggagtcaggatatatttta
ttctatcaatcaagagaatga

DBGET integrated database retrieval system