KEGG   Sarcophilus harrisii (Tasmanian devil): 100926556
Entry
100926556         CDS       T02286                                 

Gene name
CDX2
Definition
(RefSeq) homeobox protein CDX-2
  KO
K22234  homeobox protein CDX2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09160 Human Diseases
  09162 Cancer: specific types
   05226 Gastric cancer
    100926556 (CDX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100926556 (CDX2)
Transcription factors [BR:shr03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Cad
    100926556 (CDX2)
SSDB
Motif
Pfam: Caudal_act Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 100926556
NCBI-ProteinID: XP_003764520
Ensembl: ENSSHAG00000017862
UniProt: G3X060
Position
3
AA seq 298 aa
MYVSYLLDKDMSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAANLDSAQSPGPSW
PSPYGAPLREDWNGYAPGATATANSVAHGLNGGSPAAAMGYSSPADYHSHHHPHHHPHHP
GTAPSCASGLLQTLNSGPPVATAAEQLSPGGQRRNLCEWMRKPTQPSLGGQVKTRTKDKY
RVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKL
QQQQQQQPPPPQSQAQPGALRSGPEPLSPVASLQGSAPGSVPGVLGPAGGVLAPTITQ
NT seq 897 nt   +upstreamnt  +downstreamnt
atgtacgtgagctacctattggataaggacatgagcatgtaccccagctccgtgcgccat
tctggcgggctcaatttggcgccgcagaacttcgtcagtcccccgcagtacccggactac
ggaggttaccacgtggcggctgcgaacttggacagcgcccagtccccgggtccctcttgg
ccctctccttacggcgctcctctccgggaggactggaatggctatgctcccggagccacc
gctacagccaattcagtggcgcacggtctcaatggaggttcccctgccgcagctatggga
tacagcagtccggccgattaccactcacatcaccacccgcaccaccaccctcaccatcca
ggcactgcaccctcctgcgcctcggggctactgcagacactcaactccgggccgccggtg
gccactgcagctgaacagctctctccgggcggtcagcggcgcaacctgtgtgagtggatg
cggaaaccgacgcagccctccctgggcggccaggttaaaaccaggacgaaagacaaatac
cgagtcgtgtacactgaccaccagcgattggagctggagaaagagtttcactatagtcgg
tacatcaccatcaggaggaaagcagagctggctgccacattgggactatctgaaagacag
gttaaaatttggtttcaaaatcgaagagccaaggaaaggaaaattaacaagaagaaattg
cagcagcagcaacagcagcagccacctccacctcagtcacaagctcaacctggtgctttg
agaagtggcccagagccactaagtccagtagcctctctgcaaggctcagccccagggtct
gtccctggagttcttgggcctgctggaggagtgttggcccccaccatcacacagtga

DBGET integrated database retrieval system