KEGG   Sarcophilus harrisii (Tasmanian devil): 100926834Help
Entry
100926834         CDS       T02286                                 

Definition
(RefSeq) histone H2B type 2-E
  KO
K11252  histone H2B
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr05034  Alcoholism
shr05203  Viral carcinogenesis
shr05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:shr00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100926834
  Immune diseases
   05322 Systemic lupus erythematosus
    100926834
  Substance dependence
   05034 Alcoholism
    100926834
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100926834
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100926834
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 100926834
NCBI-ProteinID: XP_012404136
UniProt: G3VJ04
Position
4
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacccgccaagtccgctcctgccccgaagaagggttccaagaaggccgtcacc
aaggcgcagaagaaagacggcaagaagcgcaagcgcagccgcaaggaaagctactccatc
tacgtgtacaaggtgctgaagcaggtgcaccccgacacgggcatctcctccaaagccatg
ggcatcatgaactctttcgtcaacgatatcttcgagcgcatcgccggcgaggcgtcccgc
ctggcgcattacaacaaacgctccaccatcacgtcccgggagatccagacggccgtgcgt
ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagctccaagtaa

DBGET integrated database retrieval system