KEGG   Sarcophilus harrisii (Tasmanian devil): 100926910Help
Entry
100926910         CDS       T02286                                 

Gene name
MAP4K4
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4 isoform X4
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100926910 (MAP4K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100926910 (MAP4K4)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100926910 (MAP4K4)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: STE group
  STE20 family
   100926910 (MAP4K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 100926910
NCBI-ProteinID: XP_012401625
Ensembl: ENSSHAG00000002416
Position
3
AA seq 1307 aa AA seqDB search
MANDSPAKSLVDIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNTLKEDWIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRI
QLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGESTLRRDFLRLQ
QENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREAR
RQQEREQRRREQEEKRRLEDLERRRKEEEERRRAEEEKRRVEREQEYIRRQLEEEQRHLE
ILQQQLLQEQAMLLEYRWREMEEHRQAERLQRQLQQEQAYLLSLQHDHRRHHQQQQQQQQ
QQQQERNKQSYHPPETKPHYEAAERSREVEDRFRKTNQGSPEAQSKQTGKVLEPPVPSRS
ESFSNGNSDSVHPALQRPVEPQVPVRTTSRSPVLSRRDSPLQGSGQQNNQAGQRNSTSNI
EPRLLWERVEKLVPRPGSGSSSGSSNSGSQPGSHPGSQSGSGERFRVRSSSKSEGSPSQR
HENATKKPEEKKEIFRPHKPAGEVDLTALAKELRAVEDVRPPHKVTDYSSSSEESGTTDE
EDDDIEQEGADESTSGPEDTRAVSSLNLSNGETESVKTMIVHDDVESEPAMTPSKEGTLI
VRQSTVDQKRASHHESNGFAGRIHLLPDLLQQSHSSSTSSTSSSPSSSQPTPTMSPQTPQ
DKLTPNETQSASNTLQKHKSSSSFTPFIDPRLLQISPSSGTTVTSVVGFSGEAMRCEAIR
QDPTRKGSVVNVNPTNTRPQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDR
SGQGKVYPLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNKILHNDPEVEKKQ
GWTTVGDLEGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFGELIHKPL
LVDLTVEEGQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTHIQSSIQPHAIIILPNTDGME
LLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQIMGWGEKAIEIRSVETGHLD
GVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRTSLLSW
NT seq 3924 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgattcccctgcaaaaagtctggtggacatagacctttcctccttacgggat
cctgctgggatttttgagttggtggaagtagttggcaatggcacttatggacaagtctat
aagggccgacatgtcaagactggtcagctggcagccatcaaagtcatggatgttactgaa
gatgaagaggaagaaatcaaattggagataaatatgttgaagaaatattctcatcataga
aatattgcaacatactatggtgcttttattaaaaagagccctccaggacatgatgatcaa
ctgtggctggtgatggaattctgtggggcgggatccattacagaccttgtgaagaatacc
aaagggaacacactgaaagaagattggatcgcttatatctccagagagattctaagggga
ttggcacatcttcatgcccatcatgtgattcatcgtgacatcaagggccagaatgtactg
ctgacagaaaatgcagaggtgaaacttgttgattttggtgtcagtgctcagttggacagg
acagttggacgaagaaacactttcattggaacaccctattggatggctcctgaggtcatt
gcctgtgatgagaatcctgatgcaacttatgattacagaagtgacctttggtcctgtggc
attacagctattgaaatggcagaaggtgctccccctctctgtgacatgcatcccatgaga
gcactttttctcattcctcggaatcctcctccccggctaaagtcaaaaaaatggtcaaaa
aagttttttagctttatagaggggtgcctagtgaagaactacatgcaacgtccctctaca
gagcagcttttgaagcatccttttataagggatcagccaaatgaaaggcaagttagaatc
cagcttaaggaccatatagatcggacaagaaagaagagaggggagaaagatgagacagag
tatgagtatagtggaagtgaagaagaggaggaagaagtacctgaacaagaaggagagccc
agttccattgttaatgtgcctggtgaatctacccttcggcgggatttcttaagactgcaa
caggaaaacaaggaacgctcggaggctctacggaggcaacaacttctacaggaacagcaa
ctccgagagcaggaggaatataaaaggcaactcctggcagagaggcagaaacgcattgag
cagcagaaagagcagaggagacgactggaagagcaacaaagaagagagcgtgaagctaga
aggcaacaggagcgtgagcagaggaggagagaacaagaagagaagaggcgcctggaggac
ttagaaagaagacggaaagaagaggaagagagaagaagggcagaagaagagaagaggaga
gtagagagagagcaggagtatatcaggcgacagctagaagaggagcagcggcacttggaa
atccttcagcagcagctgctccaggagcaggccatgttactggaatacagatggcgggag
atggaagaacatcggcaggcagagagactccagaggcagttacagcaagagcaagcatat
ctcctgtccttacagcatgaccataggaggcatcaccagcagcaacagcagcagcaacaa
cagcaacagcaagaaagaaataaacagagctatcaccctcctgaaactaaacctcactat
gaagctgctgaaagatctagagaggtggaagatagatttaggaaaactaaccaaggttcc
cctgaagcacagtctaagcagacaggcaaagttttggagccaccagtgccttcaagatca
gagtctttttccaatggcaactccgattctgttcaccctgcactccagagaccagtggaa
ccacaggtacctgtgagaacaacatcccgttctcctgttttatctcgtcgtgattctcca
ctgcagggcagtgggcagcaaaataaccaagcaggtcaaagaaactctacaagcaatatt
gaacccagactgctatgggaaagggtagagaagctggtgccaaggcctggcagtggtagc
tcctcaggttcaagtaattcgggctcacagccagggtcccatcctggctctcagagtgga
tctggtgaacgcttcagagtgagatcatcatcaaaatcagaaggttcaccatcccagcgc
catgaaaatgcaacaaaaaagcctgaagagaaaaaagaaatcttcagacctcacaaacct
gctggagaagtggacttgactgcattggccaaggaacttcgagcagtagaagatgtgcga
cctcctcacaaagtaacagactattcctcatctagtgaagaatctggaacaacggatgag
gaagatgatgatatagaacaagaaggagcagatgaatctacttctggaccagaggacacc
agagcagtatcatctctgaatctgagcaatggtgaaactgaatcagtgaaaacaatgatt
gttcatgatgatgtagaaagtgaacctgccatgaccccatcaaaagagggtaccttaatc
gtccgccagagtacagttgaccaaaagcgtgccagccaccatgagagcaatggctttgcc
ggtcgcattcacctcttgccagatctcttacagcaaagccattcctcctctacttcctcc
acttcctcctccccatcctccagccagccgacacccaccatgtccccacagacaccccag
gacaagctcactcctaatgagactcagtccgctagtaacacactccagaaacacaaatct
tcctcctcctttacaccttttatagaccccagattacttcagatttctccatctagtggg
acaacagtgacttctgtggtgggattttctggtgaagcaatgagatgtgaagcaataagg
caagatcctacccgtaagggatcagttgttaatgtgaaccctacaaatactcgaccacag
agtgataccccggagattcgtaaatacaagaagagatttaattctgagatcttatgtgct
gccttatggggagttaatttgttagtaggtactgagagtggcctgatgttgctggacaga
agtggccaaggaaaggtgtatccacttattaaccgaaggcgattccaacagatggacgtt
cttgaaggcttgaatgttttagtgacaatatctggtaagaaaaataaattacgagtctac
tacttgtcttggctaaggaataaaatacttcataatgatccagaagtggagaagaaacag
ggatggacaactgtaggtgatttggaaggatgtgtacactataaagttgtaaaatatgaa
agaatcaagtttctcgtcattgctttgaaaagttcagtggaagtctatgcttgggcccca
aagccataccacaaatttatggcctttaagtcatttggagaattgatacataagccattg
ttggtcgatcttactgtagaggaagggcaacggttaaaagtgatttatggttcctgtgct
ggatttcatgctgttgatgtggactcgggatcagtctatgatatctatctacctacgcac
attcagagtagcatacaacctcatgctattatcatactccccaacacagatgggatggag
ttgctagtgtgctatgaggatgaaggggtttatgtgaatacatatggaaggattacaaag
gatgtggttctacaatggggagagatgcctacatctgttgcatatattcggtccaatcaa
atcatgggttggggtgaaaaggctattgagatacgatctgtagagactggtcacttggat
ggcgtgtttatgcataagagggcacagaggctcaaattcttatgtgaacgcaatgacaag
gtattttttgcctctgttcggtctggtggaagcagtcaggtttatttcatgactttaggc
aggacttctcttctgagctggtag

DBGET integrated database retrieval system