KEGG   Sarcophilus harrisii (Tasmanian devil): 100927618
Entry
100927618         CDS       T02286                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X2
  KO
K04829  acid-sensing ion channel 1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:shr00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100927618 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:shr04040]
    100927618 (ASIC1)
Ion channels [BR:shr04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   100927618 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 100927618
NCBI-ProteinID: XP_012405898
Ensembl: ENSSHAG00000006030
Position
5
AA seq 557 aa
MPIQIFCSLSFSSGEDSGAVRDSWGPNQQQQEKSESESEEEEEEEEEKEAKEEEEGLARD
LVAFANSCTLHGASHVFVSGGLGPRQALWAMAFTLALGTFLYQVGDRVTYYRSYPHVTLL
DEVSTSELAFPAVTFCNTNAVRLSQLSYPDLLYLAPLLGLEDGEDPGVPLAPPGPDAFSG
EPFNLHRFYNRSCHRLEDMLLYCSYRGGPCGPHNFSVVFTRYGKCYTFNAGQDGRPLLKT
MKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGF
QTFVACQEQRLIYLPPPWGTCKAVTMDSDFFDSYSITACRIDCETRYLVENCNCRMVHMP
GDAPYCTPEQYKECADPALDFLVEKDQDYCVCEMPCNLTRYGKELSMVKIPSKASAKYLA
KKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILTVL
ELFDYAYEVIKHKLCRRGRCQKESKRNSADKGVALSLDDVKRHNPCESLRGHPAGMTYAA
NILPHHPTRGTFEDFTC
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgcccatccagattttctgctctctgtctttttcctcgggtgaggactcaggggctgta
agggacagctggggacccaaccaacagcagcaagagaagtctgaatctgagtcagaagag
gaagaagaggaggaggaagagaaggaagcaaaggaggaagaggaaggcttagctagagac
ttggtggcctttgccaacagctgtaccctccatggggccagccatgtttttgtgtcagga
ggcttagggccacgccaagcgttatgggctatggcctttaccctggcactgggtaccttt
ttgtaccaggtaggagatcgggtgacctattaccgaagctatccacatgtgacactgctg
gatgaggtgtccacttctgagctggcctttccagccgttactttttgcaacaccaatgcc
gtgcggctgtcccagctcagctatcctgacctgctctacctggccccactgctcgggctg
gaggatggggaagaccctggtgtgccccttgctcccccaggccctgatgccttctctggg
gagcccttcaacttgcaccgtttctacaatcgctcctgccaccggctggaggacatgctg
ctgtactgctcctatcgagggggcccctgtggccctcacaacttttctgtggtctttaca
cgctatggaaaatgctacacattcaacgcaggccaggatgggcggccactgctcaagact
atgaagggtgggacaggcaacgggctagagataatgctggacatacaacaggatgagtac
ctgccggtctggggagagacggatgaaacttcctttgaggctgggatcaaggtgcagatc
cacagtcaggatgagccacctttcattgaccagctaggctttggtgtagctcctgggttc
cagacctttgtggcttgccaggagcaacggctcatctacctgcctccaccctggggtact
tgtaaagctgttaccatggactcagatttcttcgattcatacagcatcacagcctgtcga
attgattgtgaaacacgttatctagtggaaaactgcaattgccgcatggtgcacatgcca
ggtgatgccccatactgcacacctgagcaatataaggagtgtgcagaccctgctctggat
ttcctagtggagaaggaccaggattactgtgtgtgtgaaatgccctgtaacctgactcgc
tatggaaaggagctgtccatggtcaagattcccagcaaagcctcagccaagtatctggcc
aaaaagttcaacaagtcggagcagtacattggggagaacatcctggtgctggacatcttt
tttgaagtcttgaactatgagaccattgaacaaaaaaaagcttatgagattgcaggactc
ctgggtgacattggaggtcagatgggattgttcattggagcaagcattctcactgttctg
gagctcttcgattatgcttatgaggtgattaagcacaagctatgccgtcggggcaggtgc
cagaaagagtctaaaaggaacagtgcagacaagggtgtagccctcagtctggatgatgtc
aagcgacataacccctgtgagagcctccggggccatcctgctgggatgacatatgccgcc
aacatcctacctcaccatccgaccagaggcacctttgaggactttacctgctga

DBGET integrated database retrieval system