KEGG   Sarcophilus harrisii (Tasmanian devil): 100928277Help
Entry
100928277         CDS       T02286                                 

Gene name
PARP9
Definition
(RefSeq) poly [ADP-ribose] polymerase 9
  KO
K15260  poly [ADP-ribose] polymerase 9 [EC:2.4.2.30]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
KEGG Orthology (KO) [BR:shr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100928277 (PARP9)
Enzymes [BR:shr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     100928277 (PARP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Macro
Motif
Other DBs
NCBI-GeneID: 100928277
NCBI-ProteinID: XP_003763696
Ensembl: ENSSHAG00000004601
UniProt: G3VQ05
Position
3
AA seq 770 aa AA seqDB search
MEQKSLQIAIDSDHLKTLKSYESLFNDVINKKFQCASNLKSAMDSAKVFRTMLSSQIELS
VWKDDLTSHAVDAVVNAANEKLWHGGGLALALLRKGGPVIAMESENIIRLHQKVPVGNIG
VTSGGQLPCFKIIHAVGPQWSMTDREKCCIQLREAIVNILEYVVSGSSGIKTVAIPALSS
GIFGFPLNLCVGIIVDTIMNFSGYQRSKILKEIHLVSNEEPTVAAFKRSCEEFLGKNISA
APSLASITLNNVKLQIIEGFIEKQQVDVIVNSVSFRNSFSSGCISKAILDQAGTKIEKVF
QRLSEISKMQELVIVTTGFKLACRYVYHVVWPPVTDTKKILKDAMMNCLEKSCNHNIYSL
SFPALGTGNIGIPKEKAAHIMLEAVLQFSKDYPQKELLVNFVISPNDSKLSEIFKSELAK
MKAKGIGQMAPKMNEESDKKFEVPQWSREGQKEAASLIHLKANNEEQLAAAKKWIAKLLQ
TQERRFIENNHIFYLGKEEYDHLSLLKNHFEVSISEDISPGKATLELRGRLNRIIPMMLH
IESLLWDVQINYAQEKFSRLTDHPFSIQPEGNLIKMHFFKDKKLEEKKKEFEKAGLEVQK
VESVHNHFLLDVFKERKKKIWSKKANGNLSLTLYQEVPPQFCNLVSRVGFQRIYSMHLDS
KYGYGIYFNKTLKNLVDNLRQTSDSDDTICVFEAEVTTGSYCEGNPSYISLPSLASRTKD
TYDSVVDSVKNPETFVIFDTTQALPLFLWTCVLKKSSFSQMETKNKGTSV
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atggaacagaaaagtctacaaattgccattgacagtgatcacttaaaaaccttgaaaagc
tatgaatctttgttcaatgatgttatcaataagaagtttcaatgtgcctctaacctgaag
agtgctatggattctgccaaggtcttcaggacaatgttgtcttcccagatagagttgtct
gtctggaaagatgatctcaccagtcatgctgtggatgctgtggttaatgctgctaatgaa
aagctttggcatggaggaggcctagccttggctttgttgaggaaaggagggcctgttatt
gcaatggaaagtgaaaacataatcagacttcatcagaaagtgccagttggtaatataggt
gtaaccagtggaggccagcttccctgtttcaagattatccatgctgttggaccacagtgg
agtatgacagatcgagaaaagtgttgcattcaacttagagaagccatcgtaaatattctg
gaatatgtagtcagtggatcttctggtataaagacagtggcaatccctgcattaagctct
ggcatatttggtttccctctgaatctatgtgtaggaattattgtggataccattatgaac
ttttctggttatcaaagaagcaagatcttaaaagaaatccaccttgtgagcaatgaggaa
cccactgtggctgcatttaaaagaagctgtgaggaatttctgggtaaaaacatatcagca
gccccatctttagcttccattaccctcaacaatgtaaaactccagattatagagggattc
attgagaaacagcaggtggatgtaattgtgaattctgtatcatttcgaaattctttttca
tctggatgtatatcaaaagcaattcttgaccaagcaggcactaaaatagagaaagttttt
caaagattgtctgaaatatctaaaatgcaagagttggtaattgtcacaacaggattcaag
ttagcctgtcgatatgtgtaccacgtagtatggcctcctgtcactgatacaaagaagatt
ctgaaagatgcaatgatgaattgcttggaaaaatcctgtaaccacaatatatattcactt
tccttccctgctcttggaactgggaacatcggcatcccaaaagaaaaagcagctcatatt
atgttggaggcagttttacaattttctaaggactacccacaaaaagaactacttgtgaat
tttgtgatctctccaaatgacagcaaattatctgagattttcaaaagtgagttggccaag
atgaaggccaagggtataggacagatggcaccaaaaatgaatgaagaaagtgataaaaag
tttgaagttccacaatggtccagagaagggcaaaaagaagctgcatctttgattcacctc
aaagcaaacaatgaggaacaactggctgccgctaaaaagtggattgccaagttgttgcag
acccaggagcgccgttttattgaaaacaatcatatcttctaccttggcaaagaggagtac
gatcatttgtctcttctgaagaaccactttgaagtctccatctcagaggatatcagccct
gggaaggcaacattagagcttaggggaagattaaaccgtatcattcctatgatgctgcat
attgaaagtctgctgtgggatgtgcaaataaactatgcacaggaaaagttcagtaggcta
acagatcacccattctctatccaaccagaaggaaatttgattaagatgcattttttcaag
gataagaaacttgaggaaaagaagaaagagtttgaaaaagcgggtttggaagtgcaaaag
gttgaatcagtccataatcacttccttttggatgtctttaaagagaggaagaagaaaatt
tggagtaaaaaagcaaatggcaatttgagcctcacactataccaggaagtcccgcctcaa
ttctgcaatcttgtgagcagagttgggttccaaaggatatattccatgcatttagactcc
aaatatggttatggcatctacttcaacaagaccctcaaaaacttggtagacaatctcagg
cagacctctgactctgacgacacgatttgtgtgtttgaggctgaagtgaccacaggttcc
tattgtgagggcaatccatcctacatttctcttccttcactggcttcaagaaccaaagat
acctatgacagtgttgttgacagtgtcaagaacccagagacttttgttatttttgacacc
acacaggctctgccattgtttctgtggacctgtgtgttgaaaaagagcagtttctcccaa
atggagaccaagaataaaggcacctctgtctaa

DBGET integrated database retrieval system