KEGG   Sarcophilus harrisii (Tasmanian devil): 100929215Help
Entry
100929215         CDS       T02286                                 

Gene name
GSTT2B
Definition
(RefSeq) glutathione S-transferase theta-2B
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00480  Glutathione metabolism
shr00980  Metabolism of xenobiotics by cytochrome P450
shr00982  Drug metabolism - cytochrome P450
shr00983  Drug metabolism - other enzymes
shr01524  Platinum drug resistance
shr05200  Pathways in cancer
shr05204  Chemical carcinogenesis
shr05225  Hepatocellular carcinoma
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100929215 (GSTT2B)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100929215 (GSTT2B)
   00982 Drug metabolism - cytochrome P450
    100929215 (GSTT2B)
   00983 Drug metabolism - other enzymes
    100929215 (GSTT2B)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100929215 (GSTT2B)
   05204 Chemical carcinogenesis
    100929215 (GSTT2B)
   05225 Hepatocellular carcinoma
    100929215 (GSTT2B)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100929215 (GSTT2B)
  Drug resistance
   01524 Platinum drug resistance
    100929215 (GSTT2B)
Enzymes [BR:shr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100929215 (GSTT2B)
Transporters [BR:shr02000]
 Other Transporters
  Pores ion channels [TC:1]
   100929215 (GSTT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_3 GST_C GST_C_2 GST_N_2 GST_C_5 Tom37
Motif
Other DBs
NCBI-GeneID: 100929215
NCBI-ProteinID: XP_023354294
Ensembl: ENSSHAG00000002869
Position
2
AA seq 242 aa AA seqDB search
MGLELYLDLVSQPCRAVYLFAKANRIPFEMRSVQLLQGQQMTDDFAKVNSLKRVPALKDG
DFTLAECSAILHYLSQKYNTPGHWYPSDLQSRARVEEYLSWHADSIRGTFGTMLWIQMLG
PLVDVHVPQEKVDRNIALMTQLLQQLEEKFLQDKPFLTGDHISFADLMSLEELIQTVYAG
YDVFKDRPKLAAWRGRVEATLGEKLYQETREAIHKLCTDPSAFKDIPSAMQERMKLRLMK
IP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgggcttggaactctacctggacctggtctcccagccctgccgcgccgtctacctgttc
gccaaggctaatcgcatccccttcgaaatgcggagcgtgcagctgctgcaggggcaacaa
atgactgatgattttgccaaagtgaacagcctgaagagagtgcctgccctgaaggatgga
gatttcaccttggctgaatgttcggccatcctgcactacctgagtcagaaatacaatact
ccaggtcactggtatccttcagatctgcagtcccgggcacgggtggaggaatatctgtcc
tggcatgccgactctattcgaggaacttttggtacaatgctatggattcagatgcttggc
cctctcgttgacgtccacgtcccgcaggagaaagtggacaggaacatagccttgatgacc
cagctcctgcagcagctggaggagaagttcctgcaggacaagcccttcctcactggtgac
cacatttccttcgcggatctgatgtcgctagaggagctgatacagaccgtctatgctggt
tatgatgtcttcaaagatcggcccaagctggcagcttggcgtgggcgggtggaggccacc
ttgggggaaaagctgtaccaagagacccgggaagccatccataaactctgtacagatcct
agtgccttcaaggacatcccttcagccatgcaggagaggatgaaattacgtctcatgaag
atcccctaa

DBGET integrated database retrieval system