KEGG   Sarcophilus harrisii (Tasmanian devil): 100929481Help
Entry
100929481         CDS       T02286                                 

Definition
(RefSeq) uncharacterized protein LOC100929481
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00280  Valine, leucine and isoleucine degradation
shr00350  Tyrosine metabolism
shr00380  Tryptophan metabolism
shr00750  Vitamin B6 metabolism
shr00760  Nicotinate and nicotinamide metabolism
shr00830  Retinol metabolism
shr00982  Drug metabolism - cytochrome P450
shr01100  Metabolic pathways
shr04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100929481
   00350 Tyrosine metabolism
    100929481
   00380 Tryptophan metabolism
    100929481
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100929481
   00760 Nicotinate and nicotinamide metabolism
    100929481
   00830 Retinol metabolism
    100929481
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100929481
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100929481
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100929481
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2
Motif
Other DBs
NCBI-GeneID: 100929481
NCBI-ProteinID: NP_001295923
Ensembl: ENSSHAG00000011752
UniProt: M1ZMK8
Position
3
AA seq 1324 aa AA seqDB search
MPSHLQSDELVFFVNGKKVTEKNADPEVNLLSYLRKNLRLTGTKYACGGGGCGACTVMVS
KYDPISKKIRHCAVTACLLPICSLHGIAVTTVEGIGSTRTRIHPIQERIAKGHGTQCGFC
TPGMVMSLYALLRNYPEPSPQQLTEALGGNLCRCTGYRSILESSKTFCASNCCQMKGTGK
CCLDQEENLTLSPKKNDICTQLYTKEEFQALDPTQELIFPPELLRMAEDLNKETLTFCGE
RVTWISPITLNELLELKVKYPKSPLVMGNTSVGPAMKFQGHVHPVLLSPARISELSMVTK
TNDGLTIGAGCSLDQVMQILADEVSKLPEEKTRTYRSIVKHLKSLAGQQIRNMASLGGHI
INRHGYSDLNPILAVGNATLNLISKEGRRQIPLNEQFLAGLEDADLKPEEILESVHIPHS
DKWEFVAAFRQAQCQQNAFPDVTCGMRVLFKECTDTIEGLSIFYGGIGSTTVSAQKSCQQ
LLGRRWNALMLDEAYRLVLDEVSLPGSTPGGMVEFKRTLIVSFLFKFYLEILQELKKIIM
IPLSNSHQYPDISEKFLSALEEFPVTVSRGVQEFQGVDSNQPPHDPVGRPIHHQSGIKHA
TGEAIFCDDLPVVDKELFLALVTSTRAHAKIISIDASEALELPGVVDVITAKDIPGTNGT
DDDKLLAVDEVLCVGQIICAVVAESDVYAKRAVEKVKIIYQDQEPVIFTIEDAIRHNSYL
SSEKKLEQGNVEEAFENVDQIIEGEMHVGGQEHFYMETQRVLVIPKTEDKEMEIYISSQD
PSYVQKTVSSTLSIPINRITCHVKRVGGGFGGKVSKPAVYGAITAVAANKTGHPIRLVLD
RKEDMLIKGGRHPLFAKYKVGFMNNGRIKAMDVKCYINGGYVLDDSEMAKYLLLKLENAY
KINNLRFWGQPCKTNLPSNTAFRGFGFPQGGLLMESCITAVAAKCGLSPEKIREKNMYKR
VDKTIYKQAYSPDKLIRCWNECLDKSSYHSRKAEVENFNSKNYWKKKGIAIVPMKFSVGF
GMTTYHQAAALVHIYTDGSVLVSHGGNELGQGIHTKMLQIASRELKIPMSYMHFCETNTA
IVPNTIATAASIGSEVNGKAVQNACQILLKRLEPIIKKNPEGTWEEWVGAAFEKRISLSA
TGYFRGYKANMDWEKGEGDPFPYYVEGAACSEVEIDCLTGAHKNIRTDIVLDASCSINPA
IDIGQIEGAFIQGLGLYTLEELKYSPEGVLLCQGPDEYKIPTVTDVPEEFNGVGESGMFL
GCSVFFAISDAVAAARKERGLTDDFILNSPATPERIRMACADKFTEMIPIDDAKTFKPWC
IPIA
NT seq 3975 nt NT seq  +upstreamnt  +downstreamnt
atgccttcccatttacaatcagatgagctggtcttctttgtgaatggaaaaaaggtcaca
gaaaagaatgcagaccctgaagtaaatctgctgtcctacctgaggaagaacctccgtctc
acaggaaccaaatatgcttgcggaggaggcggctgtggggcctgtacagtgatggtatca
aagtatgaccccatttccaagaaaataagacattgtgcagttactgcttgtctgctcccc
atctgctcacttcatggaatcgcagtcaccacagtggaaggtattggtagcaccagaacc
aggattcatcccattcaggagagaattgccaaaggtcacggcactcaatgcggattctgc
actcctgggatggtgatgtccttgtatgctctcctgaggaactacccagagccctctccc
cagcagctgacagaagccctgggaggtaacctatgtcgctgcactggatatcgctcaata
ttagaaagcagcaaaactttctgtgcgtcaaactgctgtcaaatgaagggaacagggaaa
tgttgtttggatcaagaagaaaatctaactttatcacctaagaaaaatgatatctgtact
caactatacacaaaagaagagttccaggctttggatccaacacaggaactgattttcccc
ccagaactcttgagaatggcagaagatctcaataaagaaactctgactttctgtggtgag
agggttacttggatttcccctataaccctaaatgaactcttggagctgaaagtaaagtat
cctaaatctcctcttgtcatggggaatacttcagtaggaccagctatgaaattccaagga
catgttcacccagttcttctctcaccagccagaatttctgaattaagtatggtgactaaa
acaaatgatggactgacaataggtgctgggtgcagcctggatcaggtgatgcaaatcctg
gcagacgaagtctccaagcttccagaggaaaaaacacgaacatatcggagcatcgtgaag
cacttgaaaagtttggctggacagcagataaggaacatggcttccctaggtggacacatc
ataaaccgacatggctattcagatctgaatccaattctggctgtgggaaatgctaccctc
aatctgatctccaaagaaggaagacgtcagattcctttaaatgaacaatttcttgctggc
ctggaagatgcagacctgaaacctgaggaaattttggaatctgtgcacatacctcactct
gataaatgggaatttgtggcagcattcaggcaggcccagtgccagcaaaatgctttccct
gatgttacctgtggaatgagagtcctttttaaagaatgcacagacaccattgaagggctt
agcattttctacggaggcataggatccaccaccgtcagtgcacagaaatcctgccagcag
ctcctaggaagacgctggaatgcactgatgctggatgaagcttacaggttggtcctggat
gaagtctctctcccaggctcaaccccaggaggaatggtggaatttaaaagaacccttatt
gtcagtttcctcttcaagttctacctggaaatattacaagaattaaagaaaataataatg
atccctctctcaaatagccatcaatatcctgacatttcagagaagttcctaagtgctttg
gaagagtttcctgtcacagtatccagaggagtccaagaatttcaaggggtagactctaac
caacctccccatgatccagttggacggccaattcatcaccaatctggaatcaaacatgcg
actggggaagctatattttgtgatgacctgcctgttgtggataaagaacttttcctcgct
ttagtaaccagcactagggctcatgcaaaaatcatatccattgatgcatctgaggctctt
gaactaccaggtgtggttgatgtgataacagctaaggacattccaggtaccaatggcact
gacgatgacaaactgcttgctgtagatgaggtgctttgtgtgggtcagattatctgtgct
gtggttgctgaatcagatgtttatgcaaagcgggcagttgagaaggtgaagatcatttac
caggaccaggaacctgtgattttcactattgaggatgcaataaggcacaattcatacttg
tcctctgaaaaaaaactagaacaaggaaatgtggaggaggcatttgaaaatgttgatcaa
attattgagggtgagatgcatgttggaggacaagaacatttttacatggagacacaaaga
gtgcttgtcataccaaaaactgaggacaaagagatggagatttacatatcatctcaggat
ccatcctatgtacagaaaacagtgtcctctaccttaagcatccccatcaacaggatcaca
tgccacgtaaaacgagtaggtggaggctttgggggaaaggtatccaaaccagctgtgtat
ggtgcaattactgctgtggctgctaacaaaactggtcatcctattcggcttgttttagat
agaaaagaggatatgttaataaaagggggaaggcatccactttttgcaaaatataaagta
ggattcatgaacaatgggaggatcaaagctatggatgttaagtgttatatcaatggagga
tatgttctggatgactctgaaatggcaaaatatcttctactaaaactggaaaatgcttat
aaaattaataatctccgattctggggccaaccctgcaaaaccaacttgccatccaataca
gcctttcgtggatttggtttcccacaggggggattgttaatggagtcttgtatcacagcc
gtggcagccaaatgtggcttatcaccagaaaagattcgggagaaaaacatgtacaaacga
gtagataaaacaatctataagcaagcatacagtcctgacaagctgataagatgttggaat
gagtgtctggacaaatcttcctatcacagcaggaaagcagaagtggaaaattttaattca
aagaattactggaaaaagaaaggcatcgccattgttcccatgaagttttctgtcggcttt
ggtatgacaacttaccatcaggcagctgcactggttcatatatacacagatggatctgta
ctggtctctcatggaggaaatgagctggggcaaggtattcacaccaaaatgttacagatt
gccagccgtgaattaaagataccaatgtcatacatgcacttctgtgaaacaaatacagcc
atcgtgcccaacactattgctactgctgcatccattggttctgaagtcaatgggaaggcc
gtgcagaatgcctgtcagattctcttgaaacgccttgagcccatcattaagaaaaatcct
gaaggcacttgggaagagtgggtcggagcagcatttgaaaaaagaatcagcctttcagct
acaggatatttcagaggctataaagcgaacatggactgggagaaaggggaaggagaccca
tttccatactacgttgaaggagctgcctgttctgaagttgaaattgactgcctgacagga
gctcataagaatataagaactgacattgtcttagatgcaagctgcagcataaatccagcc
atagatataggacagattgaaggtgcattcattcaaggcttgggactttatacactagaa
gaactgaaatattctcctgaaggagtattgctttgtcaggggcccgatgaatacaaaatt
cctacagttacagacgtcccagaggaatttaatggtgtgggtgagtcagggatgttcctg
ggatgttctgtgttctttgctataagtgatgcagtggcagcagctcgcaaagaaagggga
ctgacggatgactttatactgaacagcccagcaactccagaacgaattcgaatggcctgt
gcagacaagttcacagagatgatcccaatagatgatgcaaagacttttaagccttggtgt
atccctattgcttaa

DBGET integrated database retrieval system