KEGG   Sarcophilus harrisii (Tasmanian devil): 100930251Help
Entry
100930251         CDS       T02286                                 

Definition
(RefSeq) dedicator of cytokinesis protein 8-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
KEGG Orthology (KO) [BR:shr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shr04131]
    100930251
Membrane trafficking [BR:shr04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100930251
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOCK_N
Motif
Other DBs
NCBI-GeneID: 100930251
NCBI-ProteinID: XP_012399383
Position
2
AA seq 229 aa AA seqDB search
FEIEIEPLFASIALYDVKERKKISENFHCDLNSEQFKGFLRNHTPLVDPSSQAKAAIFSV
TYPSSDIYLVIKIEKVLQQGEIGDCAEPYMVIKESDGGKSKEKIEKLKIQAESFCQRLGK
YRMPFAWVPISLTNFFNVSTLDREITDMETMVGKNSAGERRTLIQSRRLSEKSLSLEDSY
IGPNFKATTMTVNSFFKQEGDRLSDEDLLKFLADYKRSSSLQRRVKSIP
NT seq 689 nt NT seq  +upstreamnt  +downstreamnt
gtttgagatagaaatagaacccttatttgccagcattgccctatatgatgtgaaagaacg
gaaaaagatttcagaaaatttccattgtgacctgaattctgaacaattcaaaggattctt
acggaatcacacacccttagttgacccttctagtcaagccaaagctgcaatattctcagt
cacctacccatcttcagatatctaccttgtcattaagattgaaaaagttctccagcaggg
agagattggcgactgtgcagagccctacatggttatcaaagaaagtgatggtgggaagag
taaagaaaagattgaaaagctgaaaattcaagccgagtccttctgccagcgcttgggaaa
ataccggatgccttttgcctgggttcccataagtttaacaaatttttttaatgtttccac
tcttgatagagagataactgatatggaaaccatggttgggaaaaattctgcgggggagag
gagaacattgatccaatctagaagactttctgagaaaagcttaagcttagaagacagtta
tattggccccaatttcaaagctaccaccatgactgtaaacagttttttcaaacaggaagg
agaccgtcttagtgatgaagacttactaaaatttttagctgattacaaaagatcttcatc
cttacagagaagagtgaagtcaataccag

DBGET integrated database retrieval system