KEGG   Sarcophilus harrisii (Tasmanian devil): 100930569Help
Entry
100930569         CDS       T02286                                 

Gene name
PIGT
Definition
(RefSeq) GPI transamidase component PIG-T isoform X1
  KO
K05292  GPI-anchor transamidase subunit T
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
shr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    100930569 (PIGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 100930569
NCBI-ProteinID: XP_003757778
Ensembl: ENSSHAG00000014088
Position
2
AA seq 578 aa AA seqDB search
MAAPLVLHLLLALLLGSGGRSGAEPERDSLREELVLTPLPSGDVSATFQFRTRWDSELQL
EGVSHYRLFPKVLGQLISKYSVQELHLSLTQGFWRTRFWGQPFLQAPAGAELWVWFQDSV
VDVDKSWKELSNILSGIFCASLNFIDSTNTVTPTASFKPLGLANGTNHHFLRYAVLPREV
VCTENLTPWKKLLPCSSKAGLSVLLKAERLFHTSYHSQAVHIRPVCRDAHCVSVSWELRQ
TLTVVFDAFTTGQGKKDWSLFRMFSRTITEACPLASQSHIYVDISRNSQENETLEVSPPP
TSTYQAVVLGDRRTYAVYDLLNPATFSGSRSLNLQLRWKQFQDIGSQLVPFLHAQRYVSG
YGLQKGELSTVLHNTHPYRAFPVLLLETVPWYLRLYVHTLAITTKGKENKPSYIHYQPAQ
DRLRPHLLEMLIQLPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPNLVG
AKPANWEESPLFSTMFPVSDSSSYFVRLYTEPLLVNLPTPDFSMPYNVICLTCTVVAVCY
GSFYNLLTRTFHLEEPKRSRLVRWLANIIRRIRGVPPV
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgccgctcgtgctgcacctgctgctggcgctgctcttggggtcgggcggccgg
agcggggcagaaccagagcgggatagcctgcgggaggagctagtcctcacgccgctcccc
tccggggacgtgtcggctacgttccagttccgcacgcgttgggattcggagctgcagcta
gagggagtttctcattacagacttttccccaaggttttggggcagctgatctccaagtat
tctgtgcaagagctccatctgtcgctcactcagggcttctggaggactcggttctggggc
cagcccttcctgcaggcccctgctggggctgagctttgggtctggttccaagattccgtg
gtggatgttgataaatcctggaaggagctcagtaacatcctctcagggatcttctgcgcc
tctctcaacttcattgattccaccaatactgtcactcctactgcttccttcaaacccttg
gggctggccaatggtaccaatcatcacttcctgcgttatgctgtccttccccgagaggtg
gtgtgcactgagaacctcactccatggaaaaagctcttgccttgtagttccaaggcaggc
ctctccgtgctccttaaggctgaacgcttgttccataccagctatcactcccaggcagtg
catatccgtcctgtgtgccgggatgcccactgtgtcagtgtctcctgggagctgaggcag
accctcacagttgtgtttgatgcctttaccacaggccaggggaagaaagactggtcactc
tttcggatgttttctcgaaccatcactgaggcttgtcctttggcctcccagagtcatatc
tatgttgatatctccagaaacagtcaggagaatgagactcttgaggtgagtccaccccca
acatccacataccaggcagttgtcctgggagaccggaggacctatgctgtctatgacctg
cttaaccctgccacattcagtggctcccgcagcctcaatctgcagctcaggtggaaacag
ttccaagatattggatctcagctagttccatttctgcatgcccaacgatatgtgagtggc
tacgggctgcagaagggggagctgagcaccgtgctgcacaatacacacccgtaccgagcc
tttcctgttctgttgttggagacagtgccctggtacttacggctctacgttcatacactg
gccatcaccaccaagggcaaggagaacaagccaagttatattcattaccaacctgcacag
gaccggttgcgccctcatctcttggagatgcttattcagcttcctgccaattctgttacc
aaggtctccatccagtttgaacgtgcattgctcaagtggactgagtacacacctgaccca
aatcatggtttctatgtgagcccatccgtcctgagtgccctggtacccaatctggtggga
gccaaaccagcgaactgggaagaaagcccactcttcagtacaatgtttcctgtttctgac
agctccagttattttgtgagactctacactgagccactcctggtgaacctgcctacgcca
gacttcagcatgccctacaacgtcatctgcctcacctgcacagtcgtggctgtctgttat
ggctccttttacaaccttcttactcgtaccttccaccttgaggagcccaaacggagtagg
cttgtcaggtggttggccaatattatccgccgaatcagaggcgtcccccctgtgtga

DBGET integrated database retrieval system