KEGG   Sarcophilus harrisii (Tasmanian devil): 100931780
Entry
100931780         CDS       T02286                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00230  Purine metabolism
shr00240  Pyrimidine metabolism
shr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100931780 (DCK)
   00240 Pyrimidine metabolism
    100931780 (DCK)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     100931780 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_28 MMR_HSR1
Other DBs
NCBI-GeneID: 100931780
NCBI-ProteinID: XP_031800119
Position
6
AA seq 258 aa
MATPPKRSCPSPAAGGVRIKKIAIEGNIAAGKSTFVNILKQVSDDWEVVPEPVATWCSVQ
NTQDEFEGLTTSQKSGGNVLQMMYEKPERWSFTFQIYACLSRIRAQLCTLNGKLKETEKP
VVFFERSVYSDRYVFASNLYESDCMNETEWTIYQDWHDWMNKQFGQSLEMDGIIYLRAIP
EKCLNRIYLRGREEEQEIPLEYLEKLHHKHESWLQNRTLKTNFDYLHEIPILTLDVNEDF
KDKHENLIEKVKEFLSTL
NT seq 777 nt   +upstreamnt  +downstreamnt
atggccactccgcccaagagaagctgcccgtcgcccgccgccggcggagtccgcatcaag
aagatcgccatcgaaggcaatatcgctgcaggaaagtcgacatttgtaaatatccttaag
caagtctctgatgattgggaagtagttcctgaacctgttgccacgtggtgcagcgttcaa
aacactcaagatgaatttgagggactgacaacttctcagaaaagtggtggaaatgtgctt
cagatgatgtatgaaaaaccagaacgatggtcatttaccttccaaatctatgcctgctta
agcagaatacgagctcaactctgcactctcaatgggaagctgaaagagactgagaagcct
gtagtgttctttgaacgctctgtgtacagtgacagatatgtttttgcatctaatttatat
gagtctgattgtatgaacgaaacagaatggacaatttatcaagactggcatgactggatg
aacaaacagtttggtcaaagtcttgaaatggatggaataatttatcttcgagctattcca
gagaaatgtttaaatagaatttacttgaggggaagagaagaagaacaagaaattcctctt
gaatacttagaaaaactacatcataaacatgaaagctggctccagaatagaacactgaaa
accaactttgattatctacatgagatacccattttaacactggatgttaatgaagatttt
aaggacaagcatgaaaatctcattgaaaaggtcaaggaatttttgagcactttataa

DBGET integrated database retrieval system