KEGG   Sarcophilus harrisii (Tasmanian devil): 100932018Help
Entry
100932018         CDS       T02286                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 32-like isoform X1
  KO
K11837  ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.4.19.12]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100932018
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100932018
Ubiquitin system [BR:shr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100932018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH DUSP UCH_1 EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_5 Ubiquitin_3 Ubiquitin_2 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 100932018
NCBI-ProteinID: XP_003768045
Ensembl: ENSSHAG00000000315
Position
4
AA seq 1618 aa AA seqDB search
MGAKESRIGFLSYEEALRRVTDVELKRLKDAFKRTCGLSCYMGQQCFIREVLGDGVPPKV
AEVIYCSFGGTSKGLHFNNLIVGLVLLTRGRDEEKAKYIFSLFSNESGSYVVREEMERML
HVVDGKVPDTLRRCFSEGEKVNYEKFRNWLLQNKDAFTFSRWLLSGGVYVTLTDDSDTPT
FYQTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFGPLVSPPIHPSLSEGLFNAF
DENRDNHIDFKEISCGLSACCRGPLAERQKFCFKVFDVDRDGVLSRVELRDMVVALLEVW
KDNRTDDIPELHMNLSDIVEGILNAHDTTKKGHLTLEDYQIWSVKNVLANEFLNLLFQVC
HIVLGLRPATPEEEGQIIRGWLERESRYGLQPGHNWFIISMQWWQQWKEYVKYDSHPVVI
EPASVLNGGKNSLSAAVHPMEQGDERMGGGLNYMSPTEEKLSDNISTASEASETAGNSFL
YSGTPGTDMCFARQHNTSDNNNQCLLGSNGNILLQLNPQKPGAIDNQPLVTQEPVKATSL
TLEGGRLKRAPQLIHGRDYEMVPEPVWRALYHWYGANLALPRPVIKNSKTDLPELELFPR
YLLFLRQQPATRTQQSNIWVNMGMMSLRMFPQHLPRGNVPSPNAPLKRVLAYTGCFSRMQ
TIKEIHEYLSQRLRIKEEDMRLWLYNSENYLTLLDDEDHMLEYLKIQDEQHLVIEVRNKD
MSWPEEMSFIANSSKIDRHKVPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQYFISGR
HLYELNRTNPIGMKGHMAKCYGDLVQELWSGTQKNVAPLKLRWTIAKYAPRFNGFQQQDS
QELLAFLLDGLHEDLNRVHEKPYVELKDSDGRPDWEVAAEAWDNHLRRNRSIVVDLFHGQ
LRSQVRCKTCGHISVRFDPFNFLSLPLPMDSYMHLEITVIKLDGTTPIRYGLRLNMDEKY
TGLKKQLSDLCGLKPEQILLAEVHGSNIKNFPQDNQKVRLSVSGFLCAFEIPTPGSPISA
SSPVQTDFSGSPTNGMLNISTSGDVVRPTLIPNGMPNTVVPCGIEKNFTNGILNGHVTSF
PDSPFIGYIIAIHRKMMRTELYFLSSQKNRPSLFGMPLIVPCTVHTRKKDLYDAVWIQVS
RLASPLPPQEASNHAQDCDDSMGYQYPFTLRVVQKDGNSCAWCPWYRFCRGCKIDCAEDR
AFIGNAYIAVDWDPTALHLRYQTSQERIVEEHESVEQSRRAQAEPINLDNCLCAFTNEEE
LGENEMYYCSKCKTHCLATKKLDLWRLPPILIIHLKRFQFVNGRWIKSQKIVKFPRESFD
PSAFLVPRDPALCQRKLLTPQGEDLSEPRILQGEVKKVDPQNTWTTGEGDMLSKSPSSLS
GNINSNTKGSPSLARKNGTSCPSSKNNSPSSSPRTLGRSKGRLRLPQIGSKNKLSSSKEN
LDASRENVTDQTFELAEAMSRGHVLGGSQPELFTLQDHEATLANGFLYEHDTYNNGCSNG
HMENHSEEDSMDDQREDVCIKPIYNLYAISCHSGIMGGGHYVTYAKNPNNKWYCYNDSSC
KELHPDEIDTDSAYILFYEQQGMDYAQFLPKIDGKKMADTSSMDEDFESDYKKYCVLQ
NT seq 4857 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccaaggagtcacggatcggattcctcagctatgaggaggcgctgagaagagtc
acagatgtagagctgaagcgacttaaagatgccttcaagaggacttgtggactttcatgt
tatatgggccaacagtgcttcattagggaagtacttggggatggcgttccaccaaaagtt
gcagaggtgatatactgttcatttggtggaacatccaaagggctacactttaataatctg
atagtaggacttgttcttcttacaagagggagagatgaagagaaagcaaaatacattttt
agtcttttttcaaatgaatctgggagttatgttgtacgggaagaaatggaaaggatgctc
catgtcgtggatggaaaagtcccagatacccttaggaggtgcttttcagagggtgaaaaa
gtcaactatgagaagtttagaaactggctgctacaaaataaagatgctttcactttttcc
cgatggctgctgtctggaggtgtttatgttactctcactgatgatagtgatacccctact
ttctaccaaactctggctggagtcacacatttggaagaatcagacatcattgatcttgag
aaacgctattggctgctgaaggctcaatcccggactggccgttttgatttagagacattt
ggccctttggtttcgccacccattcatccatctctgagtgaaggtttgtttaatgccttt
gatgaaaatcgtgacaatcacatagactttaaagagatatcctgtgggttgtcagcatgt
tgcaggggacctctggctgaaagacaaaaattttgttttaaggtgttcgatgttgaccgt
gatggagtcctctctcgagttgaactaagagatatggttgttgcactcttagaggtctgg
aaggacaaccgtacggatgatatccctgaattgcacatgaatttgtcagatattgtagaa
ggtatattaaatgcacatgacaccacaaagaaggggcatcttactctggaagactatcag
atctggagtgtaaagaatgttcttgccaatgagtttttaaatctcctttttcaggtgtgc
catatagtcctgggtttgagacctgctactccagaagaagaaggacaaatcattaggggc
tggttagaaagagagagcagatatggcttgcagccaggacacaactggtttatcatttct
atgcagtggtggcagcagtggaaagaatatgtcaaatatgattctcatcctgttgtgatt
gaacctgcttctgttctgaacggagggaaaaattcactcagtgcagcagtacatcccatg
gaacagggagatgaaagaatgggtggaggtcttaattatatgagtcccacagaagagaag
ctgtccgacaatatttctactgcatcagaagcttcagagactgctggcaacagctttcta
tattctggtaccccagggactgatatgtgttttgctagacaacacaacacttcagacaat
aataatcagtgtttacttggatccaatgggaacatcttactacaactcaatccacagaaa
ccaggggctattgataaccaacctttggtaactcaagaaccagtcaaggctacatcttta
acactagaagggggacgattgaaacgagctccacagctgatccatggcagagattatgaa
atggttccagaacctgtatggagagcactttatcattggtatggcgccaatttggccctt
cctagaccagtgatcaagaacagcaaaacggacctcccagagctagaattgtttcctcgt
tatcttctcttcctgagacagcaacctgccacacggacacagcaatctaacatctgggtg
aatatgggtatgatgagcctgagaatgtttcctcaacatttacctagagggaatgtgcct
tctccaaatgctcccttaaagcgggtgttagcttatacaggctgtttcagtaggatgcag
accatcaaagaaattcatgagtatctgtctcaaagattgcgcatcaaggaagaagacatg
cgcctgtggttatacaacagtgagaactaccttactcttctggatgatgaggaccacatg
ttagaatatctgaaaattcaggatgaacaacacttagttattgaagttcggaacaaagat
atgagctggccagaagagatgtcatttatagcaaatagtagtaagatagatagacacaag
gttcccacagagaaaggagccactggcttaagtaatctgggaaacacatgttttatgaac
tccagcatccaatgtgtcagtaatacacagccattaactcaatatttcatctcagggaga
catctttatgaactcaacaggaccaaccccattggaatgaagggtcacatggccaaatgt
tatggggacttagtgcaagaactgtggagtggaacacaaaagaatgttgcccccctgaag
cttcggtggacgatagcaaaatatgcccccaggtttaatggtttccagcagcaagactcc
caggaacttctggcttttcttttggatggtcttcatgaagatctcaaccgagttcacgag
aaaccatatgtagaactgaaggacagtgatggtcgtccagactgggaagtggctgcagag
gcctgggataatcacctgagaaggaatcgatcgattgttgtagatttattccatgggcag
ctaagatcccaagtcagatgcaaaacatgtgggcatataagtgtccgatttgaccctttc
aattttttgtctttgccactacctatggatagttacatgcacttagaaatcacagttatc
aagttagatggtactactcctattcgatatgggctcaggctaaacatggatgaaaagtac
acaggattaaaaaagcaactgagtgacctctgtggacttaaaccagaacagattcttctt
gcagaagtacatggttctaacataaagaactttcctcaggacaaccaaaaggtacggctt
tcagtgagtggatttttatgtgcatttgagattcctacccctggatctcccatctcagct
tcaagtccagtacaaacagatttctctggctcacctacaaatggaatgctgaatatatcc
accagtggtgatgtggttcgaccaactcttattcccaatggaatgccaaatactgttgta
ccatgtggaattgagaagaacttcacaaatggaatactgaatggccatgtgacatcattt
cctgatagtccttttataggttacatcattgcaatccacagaaaaatgatgaggacagaa
ctttactttctgtcatctcagaagaatcgccccagcctctttggcatgccattgattgtt
ccatgtactgtgcatacacggaagaaagacctctatgatgcagtgtggattcaagtgtcc
cgactagccagcccacttcctcctcaggaagccagtaaccatgcccaggattgtgatgac
agcatggggtatcagtatccattcacactaagagttgtgcagaaggatggaaattcctgt
gcttggtgtccatggtacagattttgccgaggctgtaaaattgattgtgctgaagacaga
gctttcattggaaatgcatatattgctgtggattgggacccaacagctcttcaccttcgc
taccaaacatcacaggaacggattgtggaagaacatgagagtgtggagcagagccggaga
gcacaggcagagcctatcaacctcgacaactgtctgtgtgccttcaccaacgaagaggag
ttgggagagaatgagatgtattactgttctaagtgcaaaacccactgcttggccaccaaa
aagctggatctttggagactccccccaattctgataattcacctaaagcgatttcagttt
gtgaatggccgatggataaaatcacagaaaattgttaaatttcctcgtgagagttttgac
cccagtgcttttcttgtgccgagagatccagctctgtgccaacgaaaactactcacaccc
caaggtgaagacctctctgagccccggattcttcagggagaagtgaagaaagtggatccc
cagaatacatggaccactggggagggggatatgctgagcaagagtccatcctcactcagt
gggaatatcaacagtaacacaaaaggttctccatctttagcaagaaaaaatgggaccagt
tgtccctcaagcaaaaataacagccccagcagcagcccacggactttaggaaggagcaaa
gggcggctccggctgccccaaattggcagcaaaaataaactctcaagtagcaaagagaac
ttggatgccagtagagagaatgtcactgaccagacttttgagctggcagaggccatgagt
agagggcatgtgctaggtggcagtcaacctgagttattcactcttcaggatcatgaggcc
actttggccaacggattcctttatgagcatgatacctataataatggctgcagcaatggt
catatggaaaaccacagtgaggaagacagcatggatgaccaaagagaagatgtctgtatt
aaacctatttacaacttatatgcaatttcatgccattcaggaattatgggtgggggccat
tatgtcacttatgccaaaaacccaaacaacaagtggtactgctacaatgacagcagctgc
aaggaactccacccagatgaaattgatactgactctgcctacattcttttctatgagcaa
caggggatggactatgcacaatttctgccaaagatcgatggcaaaaagatggcagacact
agcagtatggatgaagactttgagtccgattacaaaaagtactgtgtgttacagtaa

DBGET integrated database retrieval system