KEGG   Sarcophilus harrisii (Tasmanian devil): 100932191Help
Entry
100932191         CDS       T02286                                 

Gene name
GNA13
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04022  cGMP-PKG signaling pathway
shr04071  Sphingolipid signaling pathway
shr04072  Phospholipase D signaling pathway
shr04270  Vascular smooth muscle contraction
shr04371  Apelin signaling pathway
shr04611  Platelet activation
shr04730  Long-term depression
shr04810  Regulation of actin cytoskeleton
shr04928  Parathyroid hormone synthesis, secretion and action
shr05163  Human cytomegalovirus infection
shr05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100932191 (GNA13)
   04072 Phospholipase D signaling pathway
    100932191 (GNA13)
   04071 Sphingolipid signaling pathway
    100932191 (GNA13)
   04022 cGMP-PKG signaling pathway
    100932191 (GNA13)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100932191 (GNA13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100932191 (GNA13)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100932191 (GNA13)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100932191 (GNA13)
  09156 Nervous system
   04730 Long-term depression
    100932191 (GNA13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100932191 (GNA13)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100932191 (GNA13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    100932191 (GNA13)
   04031 GTP-binding proteins [BR:shr04031]
    100932191 (GNA13)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100932191 (GNA13)
  Exosomal proteins of colorectal cancer cells
   100932191 (GNA13)
GTP-binding proteins [BR:shr04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    100932191 (GNA13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf
Motif
Other DBs
NCBI-GeneID: 100932191
NCBI-ProteinID: XP_003768613
Ensembl: ENSSHAG00000011263
Position
4
AA seq 208 aa AA seqDB search
QGESVKYFLDNLDKLGEPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSE
RKRWFECFDSVTSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILF
LNKTDLLEEKVQIVSIKDYFIEFEGNPHCLTDVQTFLVNCFRNKRRDQQQKPLYHHFTTA
INTENIRLVFRDVKDTILHDNLKQLMLQ
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
cagggtgaatctgtaaaatattttctggacaacttggataaacttggagaacctgattac
attccatcacagcaagatattctgcttgcacgaagacccacgaaaggcattcatgagtac
gactttgaaattaaaaatgttcctttcaaaatggttgatgtgggtggtcagagatcagaa
aggaaacgttggtttgaatgcttcgacagtgtaacatcaatacttttccttgtctcttca
agtgaatttgaccaggtgcttatggaagatcgactgacaaatcgccttacggaatctctg
aacatttttgaaacaatagttaacaaccgagttttcagcaatgtctctataattctcttt
ttaaataagacagacctgcttgaggaaaaagtgcaaattgtgagcatcaaagactatttc
atagaatttgaagggaatccccactgcttaacagacgtccaaactttcctggtgaattgt
ttccgtaacaaacgccgggaccagcagcagaagcctttatatcatcatttcaccactgct
attaacacagaaaatattcgacttgtttttcgtgatgtgaaggataccatccttcatgac
aacctcaaacagcttatgctacagtga

DBGET integrated database retrieval system