KEGG   Sarcophilus harrisii (Tasmanian devil): 100932634Help
Entry
100932634         CDS       T02286                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase type 6 isoform X3
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00230  Purine metabolism
shr01522  Endocrine resistance
shr04015  Rap1 signaling pathway
shr04022  cGMP-PKG signaling pathway
shr04024  cAMP signaling pathway
shr04062  Chemokine signaling pathway
shr04072  Phospholipase D signaling pathway
shr04114  Oocyte meiosis
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr04261  Adrenergic signaling in cardiomyocytes
shr04270  Vascular smooth muscle contraction
shr04371  Apelin signaling pathway
shr04540  Gap junction
shr04611  Platelet activation
shr04713  Circadian entrainment
shr04714  Thermogenesis
shr04723  Retrograde endocannabinoid signaling
shr04724  Glutamatergic synapse
shr04725  Cholinergic synapse
shr04727  GABAergic synapse
shr04742  Taste transduction
shr04750  Inflammatory mediator regulation of TRP channels
shr04911  Insulin secretion
shr04912  GnRH signaling pathway
shr04913  Ovarian steroidogenesis
shr04914  Progesterone-mediated oocyte maturation
shr04915  Estrogen signaling pathway
shr04916  Melanogenesis
shr04918  Thyroid hormone synthesis
shr04921  Oxytocin signaling pathway
shr04923  Regulation of lipolysis in adipocytes
shr04924  Renin secretion
shr04925  Aldosterone synthesis and secretion
shr04926  Relaxin signaling pathway
shr04927  Cortisol synthesis and secretion
shr04928  Parathyroid hormone synthesis, secretion and action
shr04934  Cushing's syndrome
shr04961  Endocrine and other factor-regulated calcium reabsorption
shr04962  Vasopressin-regulated water reabsorption
shr04970  Salivary secretion
shr04971  Gastric acid secretion
shr04972  Pancreatic secretion
shr04976  Bile secretion
shr05032  Morphine addiction
shr05163  Human cytomegalovirus infection
shr05166  HTLV-I infection
shr05200  Pathways in cancer
shr05414  Dilated cardiomyopathy (DCM)
Module
shr_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100932634 (ADCY6)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100932634 (ADCY6)
   04371 Apelin signaling pathway
    100932634 (ADCY6)
   04072 Phospholipase D signaling pathway
    100932634 (ADCY6)
   04024 cAMP signaling pathway
    100932634 (ADCY6)
   04022 cGMP - PKG signaling pathway
    100932634 (ADCY6)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100932634 (ADCY6)
  Cellular community - eukaryotes
   04540 Gap junction
    100932634 (ADCY6)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100932634 (ADCY6)
   04062 Chemokine signaling pathway
    100932634 (ADCY6)
  Endocrine system
   04911 Insulin secretion
    100932634 (ADCY6)
   04923 Regulation of lipolysis in adipocyte
    100932634 (ADCY6)
   04912 GnRH signaling pathway
    100932634 (ADCY6)
   04913 Ovarian Steroidogenesis
    100932634 (ADCY6)
   04915 Estrogen signaling pathway
    100932634 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    100932634 (ADCY6)
   04921 Oxytocin signaling pathway
    100932634 (ADCY6)
   04926 Relaxin signaling pathway
    100932634 (ADCY6)
   04918 Thyroid hormone synthesis
    100932634 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    100932634 (ADCY6)
   04916 Melanogenesis
    100932634 (ADCY6)
   04924 Renin secretion
    100932634 (ADCY6)
   04925 Aldosterone synthesis and secretion
    100932634 (ADCY6)
   04927 Cortisol synthesis and secretion
    100932634 (ADCY6)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100932634 (ADCY6)
   04270 Vascular smooth muscle contraction
    100932634 (ADCY6)
  Digestive system
   04970 Salivary secretion
    100932634 (ADCY6)
   04971 Gastric acid secretion
    100932634 (ADCY6)
   04972 Pancreatic secretion
    100932634 (ADCY6)
   04976 Bile secretion
    100932634 (ADCY6)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    100932634 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100932634 (ADCY6)
  Nervous system
   04724 Glutamatergic synapse
    100932634 (ADCY6)
   04727 GABAergic synapse
    100932634 (ADCY6)
   04725 Cholinergic synapse
    100932634 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    100932634 (ADCY6)
  Sensory system
   04742 Taste transduction
    100932634 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    100932634 (ADCY6)
  Aging
   04211 Longevity regulating pathway - mammal
    100932634 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    100932634 (ADCY6)
  Environmental adaptation
   04713 Circadian entrainment
    100932634 (ADCY6)
   04714 Thermogenesis
    100932634 (ADCY6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100932634 (ADCY6)
  Substance dependence
   05032 Morphine addiction
    100932634 (ADCY6)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    100932634 (ADCY6)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    100932634 (ADCY6)
  Infectious diseases
   05166 HTLV-I infection
    100932634 (ADCY6)
   05163 Human cytomegalovirus infection
    100932634 (ADCY6)
  Drug resistance
   01522 Endocrine resistance
    100932634 (ADCY6)
Enzymes [BR:shr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100932634 (ADCY6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA
Motif
Other DBs
NCBI-GeneID: 100932634
NCBI-ProteinID: XP_003770944
Ensembl: ENSSHAG00000007370
Position
5
AA seq 1158 aa AA seqDB search
MSWFSGVLVPKVDERKMAWGERNGQKRPHRGSRGSGFCGAHYMSCLQDAEPPSPTLPAPP
RCLWQDDAYSPKGGQIGGKELGLRSVALDLEDNETATLSGMPGSASSCWQHLARVFQSKQ
FRSAKLERLYQRYFFQMNQSSLTLLMGVLVLLTAVLLAFHAAPAHPHPAYVALLAGAAAL
FVALMVVCNRPGFHQDSMWVVSYVVLAVLAAVQVGMALVASPQSASAGLWCPVFFVYITY
TLLPVRMRAAVLNGLGLSVLHLLVTWQLNKGDTFLWKQLSANVLLFLCTNIIGICTHYPA
EVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVALEMKEDINTKKEDMMFHKI
YIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCY
YCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKW
QFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYLKEQQIETF
LILGASQKRKEEKAMLAKLQRTRANSNEGLMPRWVPDRSFSRTKDSKAFRQMGIDDSSKD
NRGAQEALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQTPELEKKYSRKVDARFG
GYVACMLLVFCFVCFIQLFVVPHSVLMLGLYISIFLLLTVTVLVCAIYSCGTLFPKFLQH
LSRSIVCSRAHSTAVGIFSVLLVFIAAIANMFTCNHTPIRICAARMLNLTPTDITACHLQ
HLNYSLGSDVPLCEGTTPTCSFPEYFNGSLLLSLLAGSVFLHISSIGKLLLTLVLGLLYL
ALLLLGPPAAVFDNYDLLLRAHALSLANETLYGPDCTAGEKVALKYMTPVILLVFALALY
LHAQQVESTARLDFLWKLQATGEKEDMEKLQAYNRRLLHNILPKDVAAHFLARERRNDEL
YYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEEQFRQLEKI
KTIGSTYMAASGLNAATYDRVGRSHITALADYAMRLMEQMKHINEHSFNNFQMKIGLNIG
PVVAGVIGARKPQYDIWGNTVNVSSRMDSTGIPDRIQVTTDLYQVLAAKGYQLECRGVVK
VKGKGEMTTYFLNGGPNS
NT seq 3477 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggtttagtggtgtcctggtgccaaaggtagatgagcggaagatggcatggggt
gaacgaaatggacagaagcgcccacaccgaggaagcaggggcagtggcttttgtggtgcc
cactacatgagctgcctccaggatgctgagccaccaagccccactcttccagcccctcca
cggtgtctgtggcaggatgatgcctattccccaaaggggggccaaattggagggaaggaa
ctagggctgaggagtgtggccctggacttggaggacaatgagacagcaacactcagtggg
atgcctggaagtgcaagttcttgttggcaacatctggcaagagtgtttcaatcaaaacag
tttcgatcagctaaactggaacggctctaccaacgctatttcttccaaatgaaccagagt
agcttgaccttgctaatgggggtgctggtgctattgacagctgtccttctggctttccac
gctgcccctgctcaccctcaccctgcctatgtggcactcctggctggggctgctgctctc
tttgtggccttgatggtggtatgtaaccgtcctggatttcaccaggattccatgtgggtg
gtgagctacgtagtgctggctgttctggctgctgtgcaggtgggcatggctttggtggct
tctcctcaaagtgcctcagctgggctgtggtgcccggtgttctttgtttacatcacttat
accctgttacctgtccgaatgagggcagctgtgctgaatggcctgggactctcagttctc
cacctgcttgtcacctggcagctcaacaaaggtgacaccttcctctggaagcagctcagt
gccaacgtgctcctgttcctctgtaccaatatcattggcatatgcacgcactatccagct
gaagtgtctcaacgtcaggccttccaggagactcgaggctacatccaggcccggctacac
cttcagcatgagaaccggcagcaggagcgactactgctctcagtcttgccccagcatgtt
gccttggagatgaaagaggacataaacaccaagaaagaggacatgatgtttcataagatc
tatatccagaagcatgataatgtcagcatcctgtttgctgacatcgagggcttcaccagc
ctggcctcccagtgtactgcacaggaattggtcatgacccttaatgagctcttcgcccga
tttgataaactagctgcggaaaatcactgcctacggatcaagatcttgggggactgttac
tattgtgtctctggattaccagaggcccgtgctgaccatgcccactgctgcgtggaaatg
ggtgtggacatgatcgaggctatctcgttggtgcgggaggtcacaggtgtgaatgtgaat
atgcgtgtgggtatccacagtggtcgtgtacactgtggtgttctaggccttcggaaatgg
cagtttgatgtctggtccaatgatgttaccttggcaaatcacatggaggctggaggccgg
gcaggccggatccacattaccagggctactctgcaatatctaaatggtgactatgaagta
gagcctggcaggggtggtgagcggaacgcctatctcaaagagcagcagattgagaccttc
ctgattctgggggccagtcaaaaacggaaggaggaaaaagccatgttggcaaagctacaa
cggactcgagctaactccaatgagggactgatgccacgttgggtgccagatcgttccttt
tctcgaaccaaggactctaaggctttccgccagatgggcatcgatgattcaagtaaagac
aatcgtggtgcccaggaagccctgaacccagaggatgaggtggatgaattcctgggtcgt
gccattgatgcccgaagtattgatcagttgcgcaaagaccatgtacgtcgattccttctc
acctttcagacgccagaacttgaaaagaagtattcccggaaggtggatgcccgttttggg
ggttatgtggcctgcatgctgctagtcttctgtttcgtctgcttcatccagctttttgtc
gtcccacattcagtactgatgcttggactctatatcagcatcttcctgctgctgacagtt
acagtcctagtttgtgcaatctactcctgtggcactctattcccaaagttcctgcagcac
ctctcccgtagcatcgtttgttcacgggcccacagcacagcagttggcatcttttctgtc
ttacttgtcttcatcgctgccatcgccaacatgtttacctgtaaccatactcctatacgg
atctgtgcggctcgaatgctgaacctgacacctacagacatcactgcctgtcacctgcag
catctcaactactcacttggctcggatgtccctctctgtgagggtactacacctacctgc
agctttccagagtatttcaatgggagtctgctgttgagtctcctagctggctctgtcttc
ctgcacataagcagcattggcaagctgctattgacacttgttctgggactgctatatctg
gcattgcttcttctggggcccccagctgctgtctttgacaactatgacctgctgcttcgg
gctcatgcactgtcacttgccaatgaaactctgtatgggccagactgtactgcaggtgag
aaagtggcactgaagtatatgacacctgtcatcctgttagtgtttgcattagcactctac
ttgcatgcccaacaagtggaatcaactgctcgactggactttctgtggaaattgcaggca
acaggggagaaagaagatatggaaaaactccaggcctataaccgacggttactacacaac
atcctacccaaggatgtggcggcacatttcctagcccgagaacggcgtaatgatgaactt
tactatcagtcttgtgaatgtgtggctgtcatgtttgcctccattgcaaacttctctgaa
ttctatgtggagttggaagccaataatgaaggcgttgaatgcctacgactgctcaatgag
attattgctgactttgatgagatcatcagtgaagaacagttcaggcagctggaaaagatt
aaaacaattggcagcacctatatggcagcctcaggattgaatgcagccacatatgatcgg
gtggggcgttcccatatcactgcacttgctgactatgccatgcggctcatggaacagatg
aagcacatcaatgaacactccttcaataacttccagatgaaaattgggctgaacattggc
ccagtagtggcaggcgtcattggggcaagaaagccacagtatgatatctggggcaataca
gtgaatgtgtcgagccgtatggacagcacaggaatccctgaccgaatccaagtgaccact
gacctgtaccaggttctagctgccaagggctaccagttggagtgtcgaggggtggtcaag
gtgaagggtaagggggagatgaccacctacttcctcaatggtggccccaacagttag

DBGET integrated database retrieval system