KEGG   Sarcophilus harrisii (Tasmanian devil): 100932777Help
Entry
100932777         CDS       T02286                                 

Gene name
PDK1
Definition
(RefSeq) pyruvate dehydrogenase (acetyl-transferring) kinase isozyme 1, mitochondrial
  KO
K12077  pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04066  HIF-1 signaling pathway
shr04360  Axon guidance
shr05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100932777 (PDK1)
 Organismal Systems
  Development
   04360 Axon guidance
    100932777 (PDK1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100932777 (PDK1)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100932777 (PDK1)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   100932777 (PDK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 100932777
NCBI-ProteinID: XP_012400271
Ensembl: ENSSHAG00000017496
Position
3
AA seq 429 aa AA seqDB search
MRLIRYLRRAASAGPGSGPGPSPKQGAGAGSERSVPGQVDFYSRFSPSPLSMKQFLDFGS
VNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDK
SAEDAKAVYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMS
RISIRMLLNQHSLLFGGKGKGSSAHRKHIGSINPNCNVVEVIKDGYENAKRLCDLYYINS
PELELEELNAKSPGQPMQVVYVPSHLYHMVFELFKNAMRATMEYHADKGVYPPIQVHVTL
GNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQ
YFQGDLKLYSLEGYGTDAVIYIKALSTESVERLPVYNKAAWKHYNTNHEADDWCVPSSEP
KDMTTFRSA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagattaataaggtatctgaggcgggcggcttcggccggcccgggctcgggccccggt
cccagcccaaagcaaggtgctggtgctggttccgagcgcagcgtcccgggccaggtggat
ttctactcgcgcttctccccgtccccgctctccatgaagcaatttctggacttcggatct
gtgaatgcatgtgaaaagacctcatttatgtttttgaggcaggagttgccagtgagattg
gcaaacataatgaaagaaataagtctccttccagataaccttctaagaacaccttcagtt
caactggtacagagctggtacattcagagtctacaggagcttctggattttaaagataaa
agtgctgaagatgctaaagctgtttatgattttacagacactgtgataagaatccggaat
cgacataatgatgtcattcctaccatggctcagggtgtgattgaatacaaggaaagcttt
ggtgtagatccagtgaccagccagaatgtacagtattttttggatcgcttttacatgagt
cgcatttcaataagaatgctactcaatcagcactccttactgtttggtggaaaaggaaaa
ggaagttcagctcaccgaaaacacattggaagcattaatccaaattgtaatgttgttgaa
gttattaaagatggctatgaaaatgcaaagcgtctttgtgatttgtactatattaattct
ccagaattagaacttgaagaattaaatgcaaaatcaccaggacagcccatgcaagtagta
tatgtaccatcacatctctatcacatggtgtttgaacttttcaagaatgcaatgcgagca
actatggaataccatgctgacaaaggtgtttaccctcctattcaggttcatgtaacactg
ggtaatgaggacttgactgtgaagatgagtgatcgtggaggtggtgttcctttgaggaaa
attgatagactcttcaactatatgtattcaactgcaccccgacctcgtgttgaaacatct
cgagctgtacccttggcgggttttggttatggattgcccatatctcggctttatgcacaa
tactttcaaggagacctaaaattgtattccttagaaggttatgggacggatgctgttatc
tacattaaggccctatcaacggagtcagtggagaggctccctgtatataataaagctgct
tggaaacattataataccaatcatgaggcagatgactggtgtgtgccaagcagtgaacca
aaggacatgaccacgttccgcagtgcatag

DBGET integrated database retrieval system