KEGG   Sarcophilus harrisii (Tasmanian devil): 100932999Help
Entry
100932999         CDS       T02286                                 

Gene name
SOS2
Definition
(RefSeq) son of sevenless homolog 2
  KO
K03099  son of sevenless
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04062  Chemokine signaling pathway
shr04068  FoxO signaling pathway
shr04072  Phospholipase D signaling pathway
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04540  Gap junction
shr04630  Jak-STAT signaling pathway
shr04650  Natural killer cell mediated cytotoxicity
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04714  Thermogenesis
shr04722  Neurotrophin signaling pathway
shr04810  Regulation of actin cytoskeleton
shr04910  Insulin signaling pathway
shr04912  GnRH signaling pathway
shr04915  Estrogen signaling pathway
shr04917  Prolactin signaling pathway
shr04926  Relaxin signaling pathway
shr05034  Alcoholism
shr05160  Hepatitis C
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100932999 (SOS2)
   04010 MAPK signaling pathway
    100932999 (SOS2)
   04012 ErbB signaling pathway
    100932999 (SOS2)
   04630 Jak-STAT signaling pathway
    100932999 (SOS2)
   04068 FoxO signaling pathway
    100932999 (SOS2)
   04072 Phospholipase D signaling pathway
    100932999 (SOS2)
   04151 PI3K-Akt signaling pathway
    100932999 (SOS2)
   04150 mTOR signaling pathway
    100932999 (SOS2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100932999 (SOS2)
   04540 Gap junction
    100932999 (SOS2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100932999 (SOS2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100932999 (SOS2)
   04660 T cell receptor signaling pathway
    100932999 (SOS2)
   04662 B cell receptor signaling pathway
    100932999 (SOS2)
   04664 Fc epsilon RI signaling pathway
    100932999 (SOS2)
   04062 Chemokine signaling pathway
    100932999 (SOS2)
  Endocrine system
   04910 Insulin signaling pathway
    100932999 (SOS2)
   04912 GnRH signaling pathway
    100932999 (SOS2)
   04915 Estrogen signaling pathway
    100932999 (SOS2)
   04917 Prolactin signaling pathway
    100932999 (SOS2)
   04926 Relaxin signaling pathway
    100932999 (SOS2)
  Nervous system
   04722 Neurotrophin signaling pathway
    100932999 (SOS2)
  Environmental adaptation
   04714 Thermogenesis
    100932999 (SOS2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100932999 (SOS2)
   05231 Choline metabolism in cancer
    100932999 (SOS2)
   05206 MicroRNAs in cancer
    100932999 (SOS2)
   05205 Proteoglycans in cancer
    100932999 (SOS2)
   05210 Colorectal cancer
    100932999 (SOS2)
   05225 Hepatocellular carcinoma
    100932999 (SOS2)
   05226 Gastric cancer
    100932999 (SOS2)
   05214 Glioma
    100932999 (SOS2)
   05221 Acute myeloid leukemia
    100932999 (SOS2)
   05220 Chronic myeloid leukemia
    100932999 (SOS2)
   05211 Renal cell carcinoma
    100932999 (SOS2)
   05215 Prostate cancer
    100932999 (SOS2)
   05213 Endometrial cancer
    100932999 (SOS2)
   05224 Breast cancer
    100932999 (SOS2)
   05223 Non-small cell lung cancer
    100932999 (SOS2)
  Substance dependence
   05034 Alcoholism
    100932999 (SOS2)
  Infectious diseases
   05160 Hepatitis C
    100932999 (SOS2)
   05165 Human papillomavirus infection
    100932999 (SOS2)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100932999 (SOS2)
   01522 Endocrine resistance
    100932999 (SOS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RhoGEF PH Histone IQ_SEC7_PH PH_13 PH_9
Motif
Other DBs
NCBI-GeneID: 100932999
NCBI-ProteinID: XP_003756452
Ensembl: ENSSHAG00000003599
UniProt: G3VLM7
Position
1
AA seq 1329 aa AA seqDB search
MQPPQQPYDFFSEENHPKWRGLFIPALRKVQHQVHPNLSAKEDCLYYIEELILQLLHKLC
IVQPRTVQDVEERVQKTFPHPIDKWAIADAQSAVEKRKRRTPLLLPVDKIHPLLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDESLSSGELNYYDIVRTEIAEERQYLRELNLIIKVFREAFLSNKKLFASSDI
EGIFSNILDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPQFHEHFNTLMAKPAVSLHFQSIADGFKEAVQYVLPRLMLVPVYHCSHYFELLEQLQE
CSEEQEDRECLKQAITALLNFRCSMERICNKHSPRRRPVDPVCRFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIVQCCNEFIMEGPLIRIGAKHERHIFLFDGLMISCKTNHGQSRIPG
YSNAEYRLKEKFIMRKIQICDKEDTSEYKHIFELISKDENSIIFAAKSTEEKNNWMAALI
SLQYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSGIPVIKGG
TVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLKLLIERFEIPEPEPSEADKLAVE
KGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLQLLEKLESFISSVKGK
TMKKWVESIVKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQYETFDLMTLHPIEI
ARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEAEN
FEERVAVLSRIMEILQVFQDLNNFSGVLEIVSAMNSVSVYRLEHTFEALQERKRKILEEA
VELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKQGKELINFSKRRKV
AEITGEIQQYQNQPYCLRIEAEIRRFFENLNPIGNASEKEFTDYLFNKSQEIEPRNCKQP
PRFPRKTTFSLKSPGIRPHTGRHGSTSGTLRGHPTPLEREPCKISFSRINEAEHESTASA
PTSPNTPSTPPVSASSDLSVFLDTDLNTSYGSNSIFAPVILPPSKSFLNSCGSLHKLTEE
SLVPPPLPPRKKFDQDVSTSKGNVKYDDDPPAIPPRQPPPPKIKPRVPAYSGPFEGPLPS
PPPPPPRDPLPETPLPVPLRPPEHFINYPFNLQPSPMGHTHRDPDWFREASTCPNSPNTP
PSTPSPRVPHRCVLSSNQNNLAHSQAPPIPPRQNSSPHLPKLPPKTYKRDLCQPPVYRLP
LLEHAETPQ
NT seq 3990 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgccgcaacagccttacgacttctttagtgaagagaaccatccgaaatggcgg
ggactcttcatccctgccctgcggaaggttcagcatcaagttcaccccaatctctcagca
aaagaggattgtctatattacattgaagagttgatccttcaactgctacataaattatgc
attgtacagccaaggactgttcaagatgtagaggaacgtgttcaaaagacttttcctcat
ccaattgacaaatgggctattgctgatgcacaatctgccgtagaaaaacgaaaacgaagg
acccctcttttgttacctgtggataaaattcatcctttattgaaggaagttttagggtat
aaagtagattatcatgtctctctttatattgtggctgtattggaatatatctctgctgat
attctgaaattggctggtaattatgtttttaatatcagacattatgaaatctcccagcag
gacattaaagtatcaatgtgtgcagataaggttttaatggacatgtttgatcaggatgac
attggtttggtttcactctgtgaagatgaatctctttcttcaggtgaactaaattactat
gacatagtcagaactgaaattgcagaagaaagacaatatctacgggaattaaatctaata
ataaaagtatttcgggaggcttttctttcaaacaaaaaactgttcgcatcttctgatatt
gaagggatattcagtaacattttagatattcatgaattgactgtaaagcttttaggcttg
attgaagacacagttgaaatgactgatgaaagcagtcctcatcctttagctggaagctgt
tttgaagatctagcagaagaacaagcatttgatccatatgaaaccttatcacaggatatt
ctttcaccacagtttcatgaacatttcaatactttgatggctaaacctgctgtttctcta
cattttcagtccattgctgatggctttaaagaggctgtacaatatgttcttccacgcctt
atgctagtgccagtttaccattgttcacactactttgaattattagagcaattgcaagaa
tgcagtgaagaacaagaagaccgagaatgtttaaaacaagctattactgctcttctgaat
ttccgatgtagcatggaacggatttgcaataagcattcacctagacggcgacctgtggat
cctgtttgtcgattttataatcgtcaattacggagtaagcacctggccattaaaaaaatg
aatgaaattcaaaaaaatattgatggatgggaaggcaaagatattgtccagtgttgtaat
gaatttataatggaaggaccattgataagaataggagctaagcatgaacgccatattttt
ctttttgatggcttaatgattagctgtaaaactaatcatggacaatcccggattccaggt
tatagcaatgcagagtacagattgaaagaaaaatttatcatgaggaaaatacaaatctgt
gataaagaagacacttctgaatacaagcatatctttgagttgatttccaaagatgaaaac
agcattatatttgctgctaagtccactgaagagaaaaataattggatggcagccttgatt
tctcttcagtatcgtagtacattagatcgaatgctagattcagtattattaaaagaagaa
aatgaacaaccattgaggttgccaagtccagaagtttatcgttttgttgtaaaagactcc
gaagaaaacattgtttttgaagacaacttgcaaagtggaatccctgtcattaaaggagga
actgtggtgaaattaattgaaagactaacctaccatatgtatgcagatcccaattttgtg
cgtacttttcttacaacctatcgttcattttgtaagccacaggaattgttgaagttattg
attgaacggtttgaaatccccgagccagaaccttccgaagcagataaattggcagtagag
aaaggagagcaaccaatcagtgcagacctgaaacggtttcgcaaagaatatgtccaacca
gtacaacttaggatactaaatgtatttcggcactgggtagaacatcatttttatgatttt
gagagagatctgcaattacttgaaaaattagaatcctttatttcaagtgtaaaagggaaa
acgatgaagaagtgggtagagtcaattgttaaaatcatcaagaggaaaaaacaagctcag
gcaaatggaattagccataatattacttttgaaagtccaccaccacccattgagtggcat
attagcagaccaggacagtatgaaacatttgatctcatgaccctgcatccaatagaaatt
gcacgtcaactaacacttctggaatctgacctctacagggcagttcagccttctgaactt
gtaggaagtgtgtggactaaagaagataaggaaataaattctccaaatttattgaaaatg
attcggcacactacaaatctaactctctggtttgaaaagtgcatagtagaagcagaaaac
tttgaagaacgagtggcagtattaagtaggattatggagattctgcaagtttttcaagac
ttgaacaatttcagtggtgtgttagagatagtcagtgcaatgaattcagtgtccgtatac
agattggaacatacatttgaagcattacaggaaagaaaacggaagattttagaagaagct
gtagaactaagccaagatcactttaaaaaatacctagcaaaactgaaatcaatcaaccca
ccttgtgtgcctttttttggaatatatttaacaaatattctgaagactgaagaaggtaat
aatgatttccttaaaaaacaagggaaagaattaatcaactttagtaaaagaaggaaagta
gctgaaattactggagaaattcaacagtatcagaatcagccttattgtttacggatagaa
gcagaaataaggagattctttgaaaatctcaaccctataggaaatgcatcagaaaaagaa
tttacagactatttattcaataaatcacaagaaattgaaccccgaaactgtaaacaacca
cctcgatttcctaggaaaacaactttctccttaaaatctcctggtataaggccacatact
ggcagacatggctctacttcaggcactttacgaggtcatccaactccattagaaagagaa
ccatgtaaaataagctttagtcggataaatgaggctgaacatgaatcaacagcatcagca
ccaacctctccaaacacaccatctacgccaccagtctctgcttcttcagatcttagtgta
tttttagatacagatcttaacacttcttatggaagcaacagcatctttgctccagtaatc
ttaccaccttcaaaatctttcttaaattcatgtggtagtttacataaattaactgaagag
tcactggttcctcctcctcttcctcctcgtaaaaagtttgaccaagatgtttcgacttcc
aagggaaacgtgaaatatgatgatgatcctcctgctattccaccaaggcagccaccacct
ccaaaaataaaacctcgagttcctgcttacagtggtccgtttgaagggcctttgcctagt
ccaccaccaccacctccacgagatcctcttcctgagactcctttaccagtacctcttcgg
cctcctgaacattttataaactatccatttaatcttcagccatcaccaatgggacacact
cacagagatccagattggtttcgggaagccagtacatgtccaaactcaccaaatactcct
ccaagcacaccctctccaagggtgccacatcgctgtgtgctcagttccaatcaaaataat
cttgctcattctcaagctccccctatcccaccaagacagaattcaagtcctcacttacca
aaactgccaccaaagacttacaaaagagatctttgtcaacctcctgtatatagattgccc
ttgttagaacatgcagaaactcctcagtga

DBGET integrated database retrieval system