KEGG   Sarcophilus harrisii (Tasmanian devil): 100934205Help
Entry
100934205         CDS       T02286                                 

Gene name
PDK4
Definition
(RefSeq) pyruvate dehydrogenase kinase, isozyme 4
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100934205 (PDK4)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   100934205 (PDK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3 HATPase_c_2
Motif
Other DBs
NCBI-GeneID: 100934205
NCBI-ProteinID: XP_023361339
Ensembl: ENSSHAG00000002941
Position
5
AA seq 376 aa AA seqDB search
MKQLLDFGSDNACERTSFAFLRQELPVRLANILKEIDILPDRLVKTSSVQLVRSWYIQSL
MDLVEFHEKSPEDHKALSDFVDALIKVRNRHHDVVPTMAQGIIEYKDSGAVDPVTNQNLQ
YFLDRFYMNRISTRMLMNQHILIFSDSKTGNPTHIGSIDPQCDVVAVVQDAYESARMLCD
QYYLVSPELKLTQVNGKVPDQPIHIVYVPSHLHHMLFELFKNAMRATVEHQESQPSLTPI
EVTVVLGNEDLTIKISDRGGGVPLRIIDRLFSYTYTTAPTPVMDNSRNAPLAGFGYGLPI
SRLYAKYFQGDLNLYSLSGYGTDAIIYLKALSSESIEKLPVFNKSAFKHYQAGPEAGDWC
TPSKEPRNLAKEKVAM
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagctgctggacttcggctccgacaacgcctgtgagaggacgtccttcgccttc
ctgaggcaggagctgcccgtgaggctggccaacatcctgaaagagatcgacatcctcccg
gaccgcctggtgaagacctcctccgtgcagctggtgaggagctggtacatccagagcctc
atggacttggtggagttccacgagaagagcccggaggatcacaaggctctgtctgacttt
gtagatgcgctgatcaaggtccggaaccggcaccacgacgtggttcccaccatggcccag
ggcatcatcgagtacaaggactcgggcgctgtcgacccggtcaccaaccagaacctgcag
tacttcctggacaggttctacatgaaccgcatctccacccgaatgctcatgaaccagcac
attctcatatttagcgattcgaagacgggaaaccccacgcacatcggaagcatcgacccc
cagtgtgatgtggttgctgtggtccaagatgcctacgagagtgcccgcatgctctgtgac
cagtattacctcgtttctcctgaactgaagctaacccaagtgaacggaaaggtacctgac
cagcccattcatatcgtctatgtcccctcacaccttcaccacatgctgtttgagctcttt
aagaatgccatgagggccacggtggagcaccaggaaagccagccctcgctcacgcccatt
gaggtcactgttgttctgggaaacgaagatctgaccatcaagatttcagaccgagggggc
ggggttccactgaggatcatcgaccgtctcttcagctacacctacacgacggcccccacc
cccgtgatggataactccaggaatgctcctttggctggttttgggtacggcttgccgatt
tcccgtctctacgccaagtactttcaaggggacctgaatctctattcgttgtcgggttac
ggaacggacgcaatcatctacttaaaggccctgtcttccgagtccatagaaaagctgcct
gtgttcaacaagtcggccttcaaacattaccaggccggcccggaggcaggggactggtgc
accccgagcaaggagcccaggaatctcgccaaggagaaggtggccatgtga

DBGET integrated database retrieval system