KEGG   Sarcophilus harrisii (Tasmanian devil): 100935000
Entry
100935000         CDS       T02286                                 

Gene name
TM7SF2
Definition
(RefSeq) delta(14)-sterol reductase TM7SF2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00100  Steroid biosynthesis
shr01100  Metabolic pathways
Module
shr_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    100935000 (TM7SF2)
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     100935000 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 100935000
NCBI-ProteinID: XP_031799208
Ensembl: ENSSHAG00000000998
Position
6
AA seq 421 aa
MAPPQPPTGPGDLEFGGPLGTAAMLLLLPATLFHLLLTCHSGACSLVSLPPELPPAAAFW
SPGALLLLLLWLGLQAALYLLPMGKVSQGMMLRDKSHLQYPINGFRCLGLTALLVGLGLA
GGLPLGSLSELLLPLASAATAIAFILSLLLYLKSFTVPPSALAPGGNSGNVIYDFFLGRE
LNPRFGFFDLKYFCELRPGMIGWALINLAMLLREAERRGGWPSLSMGLVNAFQLLYVVDA
LWNEEAVLTTMDIIHDGFGFMLAFGDLAWVPFVYSLQAQYLLNHPQSLELPVAGAICLLF
AIGYFIFRGANTQKNTFRRDPSDPSVAGLETIPTATGRRLLVSGWWGMVRHPNYLGDLIM
ALAWSLPCGVTHLLPYFYVVYFTILLVHREDRDERQCLQKYGLAWREYCARVPYRIVPYV
Y
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggctcccccgcagcctcccactggccccggcgacctcgaattcggggggcccctgggg
accgcggccatgctgctcctcctccccgccaccctcttccacctgctcctcacctgccac
tcgggcgcctgcagcctggtcagcctgccccccgagctgcccccggccgcggccttctgg
agccccggggccctgctgttgctgctgctctggctgggcctgcaggccgcgctctacctg
ctgcccatgggcaaggtgtctcagggcatgatgctgagggacaagagccacctgcagtat
ccgattaacgggttccggtgcctgggactgaccgcgctgctggtagggctggggctggca
ggggggctgcccctcgggagcctctcagagctgctcctacccctggcttctgcagccact
gctatagcgttcatcctcagcctccttctttacctcaaatctttcacagtgcccccttcc
gctcttgcccccgggggaaattcaggtaacgtcatctatgatttcttcctcggccgagaa
ctgaacccgcgattcggattctttgacctcaagtatttttgtgagcttcgtccagggatg
attggttgggctctgatcaacttggctatgcttttgcgggaggcagaacgccgggggggt
tggccttccttgtccatggggctggtcaatgccttccaacttctctatgtggtggacgct
ctctggaatgaggaggcagttcttaccaccatggacatcatccatgatggctttggcttc
atgctggcttttggggacctggcctgggtccccttcgtctacagtcttcaagcccagtac
ctcctgaatcatccccagtcattggaactgcctgtggctggggccatttgtctgctcttt
gcaatcggctattttatttttcgtggggccaacacacaaaaaaataccttccggagggac
ccttcagaccccagtgtggctggccttgagaccatccccacggctactggacggcgcctg
ctggtatcagggtggtggggtatggtccgtcatcctaactaccttggggacctcatcatg
gctctggcctggtctttgccctgtggggtgacacacctgcttccctacttctatgttgtc
tacttcaccatcttgctggtgcaccgggaggaccgggatgagcgccagtgtctgcagaag
tacggcctggcctggagggaatactgtgccagagtgccctaccgcatcgtaccctatgtg
tactga

DBGET integrated database retrieval system