KEGG   Sarcophilus harrisii (Tasmanian devil): 111719924Help
Entry
111719924         CDS       T02286                                 

Gene name
PRODH2
Definition
(RefSeq) hydroxyproline dehydrogenase
  KO
K11394  hydroxyproline dehydrogenase [EC:1.5.5.3]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00330  Arginine and proline metabolism
shr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    111719924 (PRODH2)
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.3  hydroxyproline dehydrogenase
     111719924 (PRODH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_dh
Motif
Other DBs
NCBI-GeneID: 111719924
NCBI-ProteinID: XP_023355781
Position
3
AA seq 325 aa AA seqDB search
MLRSGRPLLSRGVSQLRASGDQRPVLRFDGEAFRLKRTGELVRALLVLRLCAWPPLVTHG
LTLLSWSRRLLGSRLSGALLRASVYGQFVAGETTAEVQDSVQRLQGLGLRPLLAVPIEEE
PGTDRGGEAWYEGNLKAMLHCVDLSCGRDTHERLTRAAEEAERKGLGFGVKLVRGAYLES
ERALARERGTADPTQPDYEATSRSYSRCLELMLGHVCRRGSQCQLMVASHNEESVHQAVK
RMSELGIPLDGPVCFGQLLGMCDHVSLALGQAGYAIYKSIPYGALDEVIPYLLRRAQENR
SVLQGARREQGLLSQELLRRLSRSP
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgaagcggccgaccactactgtcccggggggtttcccagctgcgggcttcagga
gaccagaggcccgttttgcggtttgatggagaagctttccgcctcaaaaggacgggggaa
ctagtccgggctttgctggtgcttcggctctgcgcgtggcccccgttggtcactcatggt
ctgacgcttctgtcttggtctcggaggctcctgggctcccggctctctggggccctgctt
cgggcttcggtgtacgggcagtttgtggccggggagaccacggccgaggtgcaggactcc
gtgcagaggctccagggactggggctgcggcccctgctggctgtgcccattgaggaggag
ccggggaccgatcggggaggagaagcctggtacgagggcaacctcaaggccatgctgcac
tgtgtggacctgtcctgcggtcgcgacacgcacgagcggctgacgcgggcggccgaggag
gcagagcgcaaaggcctgggctttggggtcaagctggtccgcggcgcctacctggagagc
gagcgggcgctggcccgggagagggggaccgcggaccccacccagcctgactatgaggcc
accagccgaagttacagccgctgcctggagctgatgctgggacacgtttgccgccggggc
tcacagtgtcagctcatggtcgcttcccacaatgaagagtctgtgcatcaggcggtcaag
aggatgtccgagctgggcattcctctggacgggcccgtgtgcttcggacaattgctgggc
atgtgcgatcacgtctccctcgccctggggcaggccggctacgccatctacaagtccatc
ccctacggcgctctggacgaggtgatcccctacctgctccgccgggcccaggagaaccgg
agcgtgcttcagggggccaggagagagcaggggctgctgagccaggagctcctccgacgg
ctgtctcgcagcccatag

DBGET integrated database retrieval system