KEGG   Stereum hirsutum: STEHIDRAFT_105623Help
Entry
STEHIDRAFT_105623 CDS       T03127                                 

Definition
(RefSeq) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
shs  Stereum hirsutum
Pathway
shs00020  Citrate cycle (TCA cycle)
shs00620  Pyruvate metabolism
shs01100  Metabolic pathways
shs01200  Carbon metabolism
shs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    STEHIDRAFT_105623
   00620 Pyruvate metabolism
    STEHIDRAFT_105623
Enzymes [BR:shs01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     STEHIDRAFT_105623
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Biotin_lipoyl_2 Dala_Dala_lig_C ATP-grasp HlyD_3 HlyD_D23 ATP-grasp_3 GCV_H NQRA ATP-grasp_4 DUF2118 RnfC_N GARS_A ATPgrasp_ST PNPase PTS_EIIA_1
Motif
Other DBs
NCBI-GeneID: 18794757
NCBI-ProteinID: XP_007310623
JGI: Stehi1_105623
UniProt: R7S036
Position
Unknown
AA seq 1194 aa AA seqDB search
MTTLHPPRLAPIFAVTPSAPGTPVHSIQTMRRKAAGHSGPLTKILVANRGEIAIRVFRTA
HELAMHTVAIYSYEDRMSAHRQKADEAYRVGEGLTPVGAYLAQDDIIRIALEHGVDMIHP
GYGFLSENAEFAKKVEQAGIAFVGPTPEVIDGLGDKTKARTLAMKVGVPVVPGTPGPVDS
YGDGDAFIKEYGFPVIIKAAMGGGGRGMRVVREQSDFKESFERAVSEAKSAFGDGTVFIE
RFLERPRHIEVQILADGVGNTVHLFERDCSVQRRHQKVVEVAPAMHLPEEVRQAILSDAI
KLAKSVKYRNAGTAEFLVDQMGRHYFIEINPRIQVEHTITEEITGLDIVAAQIQIAAGAT
LPQLGLTQEAITKRGFAIQCRVTTEDASQNFQPDTGKIEVYRSAGGNGVRLDASSGFAGA
QITPHYDSLLVKVSVSGTTYEVARRKMLRALVEFRIRGVKTNIPFLFRLLTHDVFIGGKT
WTTFIDDTPELFKLVASQNRAQKLLAYLGDVAVNGSSIKGQTGEPGLKDEIVIPPFQSRE
DPENGPPLDASVPCTVGWRNIIVEHGPEAFAKAVREYPGTLIMDTTWRDAHQSLLATRLR
TIDMVNIAKETSYALANAYSLECWGGATFDVAMRFLYEDPWERLRTLRKLVPNIPLQALV
RGANGVGYTSYPDNAIYDFSKKAVENGLDIFRVFDSLNYIENMKLGIDAAKKAGGVVEAV
VCYSGDVASKKETKYTLQYYTDFVDQLYAEGIHVLGIKDMAGLLKPEAARLLVSTIRAKY
PDLPIHVHSHDTAGISTASMIAAAAAGADVVDVAIDSMSGLTSQPPMGAVCGALEQTSLG
TGIRYADIQALNLYWTQVRLLYSCFEANVRASDSSVFDHEMPGGQYTNLMFQAAQLGLGT
QWTEIKKKYIEANELCGNIIKVTPSSKVVGDFAQWMTQNSVSKQDVLDRADQLDFPSSVV
EFFQGYLGQPVGGFPEPLRSKIIRNKPRIDGRPGTNLTPLDFKKIKAELRSKFGKHITDA
DVTSYVMYPKVFEDYQGFIEKYGDLSVIPTRYFLGRPNIGEEMHISIEKGKTLIIRLMAV
GPVVEGRAQRDVWFEVNGEVRAVSVEDKNSAVETVSREKATSDPGSVGAPMSGVVVEVRV
KEGQEIKKGDPLCVLSAMKMESAVTAPVSGHIKRVAVQEGDSIAQGDLTIEIVH
NT seq 3585 nt NT seq  +upstreamnt  +downstreamnt
atgaccactcttcatcccccgaggcttgcgcctatattcgcggtgacgcctagcgcaccg
ggaacaccagtgcactctatccagacgatgaggaggaaggctgcaggacacagtggccct
ttgaccaagatcctcgtcgcgaaccgtggcgaaattgctatccgtgtcttcagaaccgcc
catgagctggcgatgcacaccgtcgctatttactcgtacgaggatcgtatgtcggcccat
cgtcaaaaggcggatgaggcttatcgcgtcggggagggcctaacccctgttggcgcctac
ctcgcccaggacgacatcatcagaattgcgttggagcatggcgttgacatgattcatcct
ggatacgggttcttgtctgagaatgctgagttcgccaagaaagtcgaacaggccggtatc
gcctttgtcggtcccacaccagaagtcatcgatggactgggtgacaagacaaaggcccgc
acgctcgccatgaaggtcggtgtgcccgtcgttcccggcactcctgggccagtcgattcg
tacggcgatggcgacgccttcatcaaagaatacggcttcccagttatcatcaaggcagcc
atgggcggtggaggtcgtggaatgcgagtcgtccgtgagcaatccgacttcaaagagtcc
ttcgaacgtgctgtcagtgaggccaagtctgcctttggtgacggtaccgtcttcatcgaa
cgtttccttgagcgcccgcgccacatcgaagtccagatccttgctgatggtgtggggaac
actgtgcacctcttcgagcgtgactgttccgtgcagaggaggcaccagaaggtcgtcgag
gttgcacctgccatgcaccttccggaggaggtcaggcaggcaatcttgtcggatgcgatt
aaactagcgaagagcgtgaagtatagaaatgcggggacagcagagttcttggttgaccag
atgggaaggcattatttcattgagatcaacccgcgtattcaggtcgagcatactatcact
gaggagatcactggactcgatatcgtcgccgcgcagattcaaattgcggccggtgctacc
ctccctcagctcggtttgacgcaggaggctatcactaagcgtggtttcgccattcagtgc
cgtgtcaccaccgaggacgcgtcgcagaacttccagcctgatactggtaagatcgaggtg
tatcgcagtgcaggtggaaatggagttcgtttggacgctagctctggtttcgcgggcgct
cagatcactcctcactacgatagtttgctcgtcaaggtgtcggttagtgggacgacgtac
gaggtggcccgtcgtaagatgcttcgcgcgttggtcgagttccgtatccgtggtgtcaag
acgaacattcccttcttgttccgtctgttgacccacgacgttttcattggtggcaagacc
tggacgacgttcatcgacgatactcctgagctattcaaactcgtggctagccagaaccgt
gctcaaaaactcttggcatacctcggcgacgttgccgtcaacggaagctctatcaagggc
caaactggcgaacctggcctcaaggacgagattgtcatccctccattccagagccgcgaa
gacccagaaaacggccccccacttgatgcctccgttccctgcaccgttggttggcgcaac
atcatcgtcgagcacggtcccgaagcgtttgccaaggctgtacgcgagtaccccggtacg
cttatcatggacacgacttggcgtgatgcgcatcagtcgttgctggcgacgaggctgagg
acaatcgatatggtgaacattgcgaaggagacgagttatgcgttggcgaatgcgtattcg
ttggagtgctggggtggcgctacgttcgatgtggcgatgaggttcttgtatgaggatcct
tgggagaggctgcgcacgctgaggaagttggtgccgaacatcccattgcaagcgcttgtg
cgtggcgctaacggagtcggatacacgagttaccccgacaatgccatctatgacttctcg
aagaaggctgttgagaatggtcttgatatcttccgtgtcttcgattcgctgaactatatc
gagaacatgaaactcggtatcgacgctgccaagaaagccggaggtgtagtcgaggccgtc
gtctgctacagtggtgacgtcgcaagcaagaaggagacaaagtatacccttcaatattac
accgactttgttgaccagctttatgctgagggcatccacgtccttggcatcaaggatatg
gctggtctgttgaagcctgaggctgcccgtctgctcgtctctaccatccgcgccaaatac
cccgacctacccatccacgttcactctcacgatacggctggtatctccacagccagtatg
atcgctgctgctgccgctggagctgatgtcgtcgacgttgccatcgacagcatgtccgga
ttgacctcccagccaccaatgggtgccgtctgcggtgctctcgaacagacctctctggga
acgggcatacgttacgctgatatccaagcattgaacctctactggacccaggtccgcctt
ctttatagctgtttcgaggccaacgtccgcgcgtccgattccagtgtcttcgaccacgag
atgcctggaggacaatacactaacctgatgttccaagcagcccagttgggtctcggaact
cagtggactgagatcaagaagaagtacatcgaggctaacgagttgtgcggaaacatcatc
aaggttacgccctcgtccaaggtcgttggtgactttgcccaatggatgacgcagaactct
gtctcgaagcaagacgtgcttgaccgcgccgaccagctcgacttcccatcatcagtcgtc
gagttcttccaaggataccttggtcagcccgtcggcggtttccccgagccccttaggtcc
aagatcattaggaacaagccgaggatcgatggtcgtcccgggaccaacctgacgcccttg
gacttcaagaagatcaaggccgagctgaggagcaagtttggaaagcacattaccgacgcg
gatgtgacttcgtatgtgatgtaccctaaggttttcgaagattaccagggcttcatcgag
aaatatggtgacttaagtgtcattcccacacgttacttcttgggtcgtcccaacatcggc
gaggagatgcatatctccatcgagaagggcaaaaccctgatcattcgtctgatggctgtc
ggacctgtggtcgagggccgtgcgcagcgcgacgtctggttcgaggtcaatggcgaagtc
cgtgctgtctctgtggaggacaagaactccgccgtcgagaccgtctcccgcgagaaggcg
acgtctgaccctgggtctgtgggtgcaccaatgtcgggtgtcgtggtggaggtccgtgtc
aaggagggccaagagatcaagaagggtgatcctctgtgcgtcctaagcgcgatgaagatg
gagtctgccgtcactgccccagtctctggccacatcaaacgtgttgcggtgcaagaaggt
gattccatcgcgcaaggcgacctgacgattgagatcgtccactga

DBGET integrated database retrieval system