KEGG   Stereum hirsutum: STEHIDRAFT_117683Help
Entry
STEHIDRAFT_117683 CDS       T03127                                 

Definition
(RefSeq) PARP-domain-containing protein
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
shs  Stereum hirsutum
Pathway
shs03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:shs00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    STEHIDRAFT_117683
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:shs03032]
    STEHIDRAFT_117683
   03036 Chromosome and associated proteins [BR:shs03036]
    STEHIDRAFT_117683
   03400 DNA repair and recombination proteins [BR:shs03400]
    STEHIDRAFT_117683
Enzymes [BR:shs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     STEHIDRAFT_117683
DNA replication proteins [BR:shs03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     STEHIDRAFT_117683
Chromosome and associated proteins [BR:shs03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    STEHIDRAFT_117683
DNA repair and recombination proteins [BR:shs03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     STEHIDRAFT_117683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg WGR HMG_box_5
Motif
Other DBs
NCBI-GeneID: 18796156
NCBI-ProteinID: XP_007299030
JGI: Stehi1_117683
Position
Unknown
AA seq 527 aa AA seqDB search
MVSVIKRGAAPVDPQSGYVATHQVYASGGQVWDAMMNQTDVGKNANKFYVIQLLHPIGNH
SSIILITRWGRVGESGSQQVKGPFPPAAAVDEFKKQFKSKTSTAWEKRHGMTAKKGKYMW
LERAFEDEENDEDEDSAEAGPSGSKPESKAVIPKSTLAQELQTVCRLIFNKSLIDAHLSS
MNYDANKLPLGKLAKSTILNGFSALKSLSEVIADPAGAVATEYGSYAAACQELTNTYYSI
IPHAFGRSRPTVISDMAILKKELELVDALGDMEVAQKLIQTATPKDKHGNPVNPLDAQFL
SLQLSNMEPINADSQEFKALNAYANDTHGVTHSHMKINIQHAYRVERESETKAWHQGGHN
KLEDGNRMLLWHGSRTTNFAGILRQGLRIAPPEAPVSGYMFGKGVYFADMVSKSAGYCHT
HLSDGTGLLLLCEVAAKPFFEQENANYNADKDCKANNKLCTLGLGQWRPEVWKDAGDALG
NDALKGCVMPEGPAVQDPKHHSLWYNEYIVYDTSQIRLRYMIMFKTN
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggtctccgtcatcaagagaggcgcagcgcctgttgatccccagagtggatacgtcgcc
acgcatcaagtctatgcttctggtgggcaggtctgggatgctatgatgaaccagacggac
gtagggaagaacgcaaacaagttctatgtgatacaattattgcaccccattggcaaccac
tcttctataattctcatcactcggtggggtcgtgttggtgagagcggatcgcagcaggtc
aaaggtccatttccgcccgctgcagcggttgatgagttcaaaaagcaattcaagtccaag
acgtccactgcttgggaaaagaggcatggcatgacagccaaaaagggcaagtatatgtgg
ctggaacgtgcatttgaggacgaagagaacgacgaagatgaagacagcgccgaagcgggt
ccctcaggctcgaaacccgagagcaaggcggttataccgaagtccacccttgcacaggaa
cttcagaccgtttgccgtcttatcttcaacaagagtctcatagatgcccacttgtcttcc
atgaactacgacgcgaataagctgccgttgggcaaacttgcgaagtccacaatcctgaac
gggttctccgctctcaagtctctttccgaagtcattgctgatcccgctggtgctgtggcg
actgaatacggaagttacgctgcggcgtgtcaggaactcactaatacctactattccatc
attcctcatgcctttgggagaagtcggcccacagtcatcagcgatatggctatcctcaag
aaagagcttgaactcgttgacgccctaggagacatggaagtcgcgcagaaactcatccag
actgcgactccgaaggacaagcatggcaatcctgtgaacccactggacgctcaattcctc
tcccttcagctatcgaacatggaacctatcaacgcggacagccaggagttcaaggcatta
aatgcttacgcgaatgatacgcacggcgtcactcacagccacatgaagattaatattcag
cacgcttatcgcgtggaaagagagtctgaaactaaggcatggcatcagggcggacacaat
aagctggaagatggcaacaggatgctgctttggcacggttctaggaccactaacttcgcc
ggtatactccgacagggtcttcgtattgctcctcccgaagctcctgtttccgggtacatg
ttcggtaaaggcgtgtacttcgcagatatggtttccaaatccgcaggctactgccatacc
cacttgagtgacgggacgggtttgctacttctttgcgaggttgcagccaagccgttcttc
gagcaagagaatgccaactataacgccgacaaggattgtaaggcgaacaacaagctttgc
accctcggtctcggacagtggcgtcctgaggtctggaaggacgctggcgacgcgttgggt
aacgatgccttgaaaggatgcgtcatgcccgaaggaccagcggtccaggacccgaaacac
cacagtctgtggtacaatgagtacatcgtgtacgacacgtcgcagatccgcctgcgctac
atgatcatgttcaagaccaattga

DBGET integrated database retrieval system